Prionailurus bengalensis (leopard cat): 122488549 Help Entry 122488549         CDS       T07574                                  Symbol RHEB Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism pbg  Prionailurus bengalensis (leopard cat) Pathway pbg04072   Phospholipase D signaling pathway pbg04140   Autophagy - animal pbg04150   mTOR signaling pathway pbg04151   PI3K-Akt signaling pathway pbg04152   AMPK signaling pathway pbg04211   Longevity regulating pathway pbg04218   Cellular senescence pbg04714   Thermogenesis pbg04910   Insulin signaling pathway pbg04919   Thyroid hormone signaling pathway pbg05163   Human cytomegalovirus infection pbg05165   Human papillomavirus infection pbg05168   Herpes simplex virus 1 infection pbg05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:pbg00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     122488549 (RHEB)    04151 PI3K-Akt signaling pathway     122488549 (RHEB)    04152 AMPK signaling pathway     122488549 (RHEB)    04150 mTOR signaling pathway     122488549 (RHEB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     122488549 (RHEB)   09143 Cell growth and death    04218 Cellular senescence     122488549 (RHEB)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     122488549 (RHEB)    04919 Thyroid hormone signaling pathway     122488549 (RHEB)   09149 Aging    04211 Longevity regulating pathway     122488549 (RHEB)   09159 Environmental adaptation    04714 Thermogenesis     122488549 (RHEB)  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     122488549 (RHEB)   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     122488549 (RHEB)    05163 Human cytomegalovirus infection     122488549 (RHEB)    05165 Human papillomavirus infection     122488549 (RHEB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:pbg04031]     122488549 (RHEB) GTP-binding proteins [BR:pbg04031]  Small (monomeric) G-proteins   Ras Family    Rheb     122488549 (RHEB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB AAA_14 RhoGAP_pG1_pG2 DUF1842 Motif Other DBs NCBI-GeneID:  122488549 NCBI-ProteinID:  XP_043445906 LinkDB All DBs Position A2:complement(163060001..163104911) Genome browser AA seq 184 aa AA seqDB search MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSS CSVM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc tcattgacgattcagtttgttgaaggccaatttgttgactcctacgacccaaccatagaa aacactttcacaaaattgatcacagtaaatggacaagaatatcatcttcagcttgttgac acagctggacaagatgaatactccatctttcctcagacatactccatagatattaatggt tatattcttgtgtattctgttacatcaatcaaaagttttgaagtgattaaagttattcac ggcaaattgttggacatggtggggaaagtgcaaatacctattatgctggtcgggaataag aaagatctacacatggaaagggtgatcagttatgaagaagggaaagcattagcagagtct tggaacgcagcttttttggaatcttctgctaaagaaaatcagaccgctgttgacgttttt agaaggataattttggaggcagaaaaaatcgatggggccgcgtcacaaggaaagtcttcc tgctcggtgatgtga

DBGET integrated database retrieval system