Prionailurus bengalensis (leopard cat): 122488669 Help Entry 122488669         CDS       T07574                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism pbg  Prionailurus bengalensis (leopard cat) Pathway pbg04140   Autophagy - animal pbg04144   Endocytosis pbg04152   AMPK signaling pathway pbg04530   Tight junction pbg04972   Pancreatic secretion pbg05014   Amyotrophic lateral sclerosis pbg05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:pbg00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     122488669 (RAB8A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     122488669 (RAB8A)    04140 Autophagy - animal     122488669 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     122488669 (RAB8A)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     122488669 (RAB8A)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     122488669 (RAB8A)    05022 Pathways of neurodegeneration - multiple diseases     122488669 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pbg04131]     122488669 (RAB8A)    03036 Chromosome and associated proteins [BR:pbg03036]     122488669 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pbg04147]     122488669 (RAB8A)    04031 GTP-binding proteins [BR:pbg04031]     122488669 (RAB8A) Membrane trafficking [BR:pbg04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     122488669 (RAB8A)  Autophagy   Other autophagy associated proteins     122488669 (RAB8A) Chromosome and associated proteins [BR:pbg03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     122488669 (RAB8A) Exosome [BR:pbg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122488669 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    122488669 (RAB8A)   Exosomal proteins of colorectal cancer cells    122488669 (RAB8A) GTP-binding proteins [BR:pbg04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     122488669 (RAB8A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 DUF3963 Septin DUF6974 AAA_7 Motif Other DBs NCBI-GeneID:  122488669 NCBI-ProteinID:  XP_043446208 LinkDB All DBs Position A2:12150193..12168961 Genome browser AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN SPQGSSQGVKITPDQQKRSSFFRCVLL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg aagacctgtgtcctgttccgcttctccgaggacgcgttcaactcaactttcatctccacc ataggaattgactttaaaattaggaccatagagctcgatggcaagagaattaagctacag atatgggacacagctggtcaggaacggtttcggacgatcacaacggcctactacaggggc gcaatgggcatcatgctggtctatgacatcaccaacgagaaatcctttgacaacatccgg aactggattcggaatattgaggagcatgcttctgcagatgtcgaaaagatgatactcggg aacaagtgtgacgtgaacgacaagagacaagtgtccaaggaacggggagagaagctcgcc ctggactatggaatcaagttcatggagaccagtgcgaaggccaacatcaacgtggagaac gcatttttcactctcgccagagacatcaaagcaaaaatggacaaaaaactggaaggcaac agtccccaagggagcagccagggagtcaaaatcaccccagaccagcagaagagaagcagc tttttccgatgtgttcttctgtga

DBGET integrated database retrieval system