Prionailurus bengalensis (leopard cat): 122489627 Help Entry 122489627         CDS       T07574                                  Symbol GSTA4 Name (RefSeq) glutathione S-transferase A4   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism pbg  Prionailurus bengalensis (leopard cat) Pathway pbg00480   Glutathione metabolism pbg00980   Metabolism of xenobiotics by cytochrome P450 pbg00982   Drug metabolism - cytochrome P450 pbg00983   Drug metabolism - other enzymes pbg01100   Metabolic pathways pbg01524   Platinum drug resistance pbg05200   Pathways in cancer pbg05204   Chemical carcinogenesis - DNA adducts pbg05207   Chemical carcinogenesis - receptor activation pbg05208   Chemical carcinogenesis - reactive oxygen species pbg05225   Hepatocellular carcinoma pbg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pbg00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     122489627 (GSTA4)   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     122489627 (GSTA4)    00982 Drug metabolism - cytochrome P450     122489627 (GSTA4)    00983 Drug metabolism - other enzymes     122489627 (GSTA4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122489627 (GSTA4)    05204 Chemical carcinogenesis - DNA adducts     122489627 (GSTA4)    05207 Chemical carcinogenesis - receptor activation     122489627 (GSTA4)    05208 Chemical carcinogenesis - reactive oxygen species     122489627 (GSTA4)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     122489627 (GSTA4)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     122489627 (GSTA4)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     122489627 (GSTA4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pbg02000]     122489627 (GSTA4) Enzymes [BR:pbg01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      122489627 (GSTA4) Transporters [BR:pbg02000]  Other transporters   Pores ion channels [TC:1]    122489627 (GSTA4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_2 GST_N_2 GST_N_3 Motif Other DBs NCBI-GeneID:  122489627 NCBI-ProteinID:  XP_043447587 LinkDB All DBs Position B2:complement(49998783..50013468) Genome browser AA seq 222 aa AA seqDB search MAAKPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLQKLQDGNHLLFQQVPMVEI DGMKLVQTRSILHYIAEKHHLFGKDLKERTLIDMYVEGTLDLLELIIMHPFLKPDDQQKE VVNMAQKAIIRYFPVFEKVLRDHGQRFLVGNQLSLADVILLQTILALEEKIPNILSAFPH LQEFTVKISNIPTIKKFLEPGSKKKPPPDDIYVRTVYNIFMP NT seq 669 nt NT seq  +upstreamnt  +downstreamnt atggcagcaaagcccaagctccactatcccaacggaagaggccggatggagtccgtaaga tgggttttagctgccgctggagtcgagtttgatgaagagttcttagaaacaaaagaacag ttacagaagttgcaggatggtaaccacctgctgttccagcaagtgccaatggttgaaatt gacgggatgaagttggtgcagacccgcagcatccttcactacatagcagagaagcaccac ctgtttggcaaggatctcaaggagagaaccctgattgacatgtatgtggaggggacgcta gatctgctggaactgattatcatgcatcctttcctaaaaccagatgatcaacaaaaggaa gtggttaacatggcccagaaggctataattagatactttcctgtgtttgaaaaggtttta agggatcatgggcaaaggtttctcgttggtaaccagctgagccttgcggacgtgattcta ctccaaaccattttggctctagaagagaaaatccccaatatcctgtctgcatttcctcac ctccaggagttcacagtgaaaatcagtaatatccctacaattaagaaattccttgaacct ggcagcaagaagaagcctcctccagatgacatctacgtgagaaccgtctacaacatcttt atgccctaa

DBGET integrated database retrieval system