Prionailurus bengalensis (leopard cat): 122490286 Help Entry 122490286         CDS       T07574                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism pbg  Prionailurus bengalensis (leopard cat) Pathway pbg04613   Neutrophil extracellular trap formation pbg05034   Alcoholism pbg05202   Transcriptional misregulation in cancer pbg05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pbg00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     122490286  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     122490286   09163 Immune disease    05322 Systemic lupus erythematosus     122490286   09165 Substance dependence    05034 Alcoholism     122490286  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pbg03036]     122490286   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pbg04147]     122490286 Chromosome and associated proteins [BR:pbg03036]  Eukaryotic type   Nucleosome assembly factors    Histones     122490286 Exosome [BR:pbg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122490286 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  122490286 NCBI-ProteinID:  XP_043448830 LinkDB All DBs Position B2:3987294..3991668 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgcacgaagcagacagcgcgcaagtcgacgggcggcaaggccccgcgcaagcag ctggccaccaaggcggcccgcaagagcgcgccggccaccggcggcgtcaagaagccgcac cgctaccggcccggcacggtggccctgcgcgagatccgccgctaccagaagtccaccgag ctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgtgcgaggcctac ctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagctggcgcgccgcatccgcggcgagagggcgtaa

DBGET integrated database retrieval system