Prionailurus bengalensis (leopard cat): 122490316 Help Entry 122490316         CDS       T07574                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism pbg  Prionailurus bengalensis (leopard cat) Pathway pbg04613   Neutrophil extracellular trap formation pbg05034   Alcoholism pbg05203   Viral carcinogenesis pbg05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pbg00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     122490316  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     122490316   09163 Immune disease    05322 Systemic lupus erythematosus     122490316   09165 Substance dependence    05034 Alcoholism     122490316  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pbg03036]     122490316 Chromosome and associated proteins [BR:pbg03036]  Eukaryotic type   Nucleosome assembly factors    Histones     122490316 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  122490316 NCBI-ProteinID:  XP_043448863 LinkDB All DBs Position B2:3753393..3753805 Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggccgaggcaaaggcgggaagggtctgggcaaagggggcgccaagcgccaccgc aaggtgctgcgcgacaacatccagggtatcaccaagcccgccatccggcggctggcccgg cgcggcggcgtcaagcgcatctccggcctcatctacgaggagacccgcggggtgctcaag gtgttcctggagaacgtgatccgggacgccgtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtgtacgcactcaagcgccagggccgcaccctctacggc ttcggcggctga

DBGET integrated database retrieval system