KEGG Orthology (KO) [BR:pbg00001]
09120 Genetic Information Processing
09121 Transcription
03020 RNA polymerase
122491662 (POLR2H)
09124 Replication and repair
03420 Nucleotide excision repair
122491662 (POLR2H)
09150 Organismal Systems
09151 Immune system
04623 Cytosolic DNA-sensing pathway
122491662 (POLR2H)
09160 Human Diseases
09164 Neurodegenerative disease
05016 Huntington disease
122491662 (POLR2H)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:pbg03021]
122491662 (POLR2H)
03400 DNA repair and recombination proteins [BR:pbg03400]
122491662 (POLR2H)
Transcription machinery [BR:pbg03021]
Eukaryotic type
RNA polymerase II system
RNA polymerase II
Pol I, II, III common subunits
122491662 (POLR2H)
RNA polymerase III system
RNA polymerase III
122491662 (POLR2H)
RNA polymerase I system
RNA polymerase I
122491662 (POLR2H)
DNA repair and recombination proteins [BR:pbg03400]
Eukaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
TCR (transcription coupled repair) factors
DNA-directed RNA polymerase II complex
122491662 (POLR2H)
150 aa
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVI
ASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGG
LLMRLQGDANNLHGFEVDSRVYLLMKKLAF