Prionailurus bengalensis (leopard cat): 122491863 Help Entry 122491863         CDS       T07574                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism pbg  Prionailurus bengalensis (leopard cat) Pathway pbg04015   Rap1 signaling pathway pbg04810   Regulation of actin cytoskeleton pbg05014   Amyotrophic lateral sclerosis pbg05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pbg00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     122491863 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     122491863 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     122491863 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     122491863 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pbg04131]     122491863 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pbg04812]     122491863 (PFN2)    04147 Exosome [BR:pbg04147]     122491863 (PFN2) Membrane trafficking [BR:pbg04131]  Others   Actin-binding proteins    Others     122491863 (PFN2) Cytoskeleton proteins [BR:pbg04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      122491863 (PFN2) Exosome [BR:pbg04147]  Exosomal proteins   Proteins found in most exosomes    122491863 (PFN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  122491863 NCBI-ProteinID:  XP_043451084 LinkDB All DBs Position C2:115089174..115109418 Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc cagagcattacgccagtagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaacggtttgactcttggcgcaaagaagtgctcagtgatcagagatagcctatacgtc gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaac gttgctgtcggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system