Prionailurus bengalensis (leopard cat): 122496407 Help Entry 122496407         CDS       T07574                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism pbg  Prionailurus bengalensis (leopard cat) Pathway pbg01521   EGFR tyrosine kinase inhibitor resistance pbg01524   Platinum drug resistance pbg04014   Ras signaling pathway pbg04064   NF-kappa B signaling pathway pbg04115   p53 signaling pathway pbg04137   Mitophagy - animal pbg04140   Autophagy - animal pbg04151   PI3K-Akt signaling pathway pbg04210   Apoptosis pbg04215   Apoptosis - multiple species pbg04621   NOD-like receptor signaling pathway pbg04630   JAK-STAT signaling pathway pbg05012   Parkinson disease pbg05014   Amyotrophic lateral sclerosis pbg05022   Pathways of neurodegeneration - multiple diseases pbg05145   Toxoplasmosis pbg05162   Measles pbg05166   Human T-cell leukemia virus 1 infection pbg05168   Herpes simplex virus 1 infection pbg05170   Human immunodeficiency virus 1 infection pbg05200   Pathways in cancer pbg05202   Transcriptional misregulation in cancer pbg05212   Pancreatic cancer pbg05220   Chronic myeloid leukemia pbg05222   Small cell lung cancer pbg05225   Hepatocellular carcinoma pbg05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pbg00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     122496407 (BCL2L1)    04630 JAK-STAT signaling pathway     122496407 (BCL2L1)    04064 NF-kappa B signaling pathway     122496407 (BCL2L1)    04151 PI3K-Akt signaling pathway     122496407 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     122496407 (BCL2L1)    04137 Mitophagy - animal     122496407 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     122496407 (BCL2L1)    04215 Apoptosis - multiple species     122496407 (BCL2L1)    04115 p53 signaling pathway     122496407 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     122496407 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122496407 (BCL2L1)    05202 Transcriptional misregulation in cancer     122496407 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     122496407 (BCL2L1)    05225 Hepatocellular carcinoma     122496407 (BCL2L1)    05220 Chronic myeloid leukemia     122496407 (BCL2L1)    05222 Small cell lung cancer     122496407 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     122496407 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     122496407 (BCL2L1)    05162 Measles     122496407 (BCL2L1)    05168 Herpes simplex virus 1 infection     122496407 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     122496407 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     122496407 (BCL2L1)    05014 Amyotrophic lateral sclerosis     122496407 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     122496407 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122496407 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     122496407 (BCL2L1)    01524 Platinum drug resistance     122496407 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pbg01009]     122496407 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pbg03036]     122496407 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pbg02000]     122496407 (BCL2L1) Protein phosphatases and associated proteins [BR:pbg01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      122496407 (BCL2L1) Chromosome and associated proteins [BR:pbg03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     122496407 (BCL2L1) Transporters [BR:pbg02000]  Other transporters   Pores ion channels [TC:1]    122496407 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  122496407 NCBI-ProteinID:  XP_043458572 LinkDB All DBs Position A3:27033641..27082418 Genome browser AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaggccccagaaggg actgaatcagagatggagacccccagtgccatcaatggcaacccatcctggcacttggcg gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg atccccatggcagcggtgaagcaggcgctgagggaggccggggatgagtttgaactgagg taccggcgggcattcagcgacctgacatcccagcttcacatcaccccagggacagcatat cagagctttgagcaggtagtgaacgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggatcgcaacttggatggccacttacctgaacgaccacctagagcct tggatccaggagaacggcggctgggacacttttgtggaactctacgggaacaatgcagcg gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacaggcatgactgtg gctggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system