Prionailurus bengalensis (leopard cat): 122497395 Help Entry 122497395         CDS       T07574                                  Symbol PFN4 Name (RefSeq) profilin-4 isoform X1   KO K05759   profilin Organism pbg  Prionailurus bengalensis (leopard cat) Pathway pbg04015   Rap1 signaling pathway pbg04810   Regulation of actin cytoskeleton pbg05014   Amyotrophic lateral sclerosis pbg05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pbg00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     122497395 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     122497395 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     122497395 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     122497395 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pbg04131]     122497395 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pbg04812]     122497395 (PFN4)    04147 Exosome [BR:pbg04147]     122497395 (PFN4) Membrane trafficking [BR:pbg04131]  Others   Actin-binding proteins    Others     122497395 (PFN4) Cytoskeleton proteins [BR:pbg04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      122497395 (PFN4) Exosome [BR:pbg04147]  Exosomal proteins   Proteins found in most exosomes    122497395 (PFN4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  122497395 NCBI-ProteinID:  XP_043460367 LinkDB All DBs Position A3:121557168..121562656 Genome browser AA seq 129 aa AA seqDB search MSHLQNLLLDTLLGTKHVDSAALIKLQERSLSVASPGFSVMPSDVRTLVNGFAKNPLQTR REGLYFKEKDYKCVRADDYSLYAKNENTGVVVVKTHLYLLVATYTEGMYPSVCVEATEKL GEYLRRKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatttgcagaacttactgttagataccctcctgggaacaaagcatgtggacagt gcagccctcatcaaactccaggagcgaagcttgagtgtagcatcaccaggatttagtgta atgcccagtgatgtccgaactcttgtgaatggattcgccaagaaccctttgcaaaccaga agagaaggactgtatttcaaggaaaaggactacaaatgtgtccgggcagatgactattct ctttatgctaagaatgaaaacactggtgtggttgttgtgaagacccatctgtatcttctg gtggcaacttacactgaaggcatgtatcctagtgtttgtgtggaagccacagagaaactg ggagaatatctaagaagaaaaggaaattaa

DBGET integrated database retrieval system