Python bivittatus (Burmese python): 103049329 Help Entry 103049329         CDS       T03091                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism pbi  Python bivittatus (Burmese python) Pathway pbi04081   Hormone signaling pbi04144   Endocytosis pbi04150   mTOR signaling pathway pbi04270   Vascular smooth muscle contraction pbi04310   Wnt signaling pathway pbi04350   TGF-beta signaling pathway pbi04510   Focal adhesion pbi04520   Adherens junction pbi04530   Tight junction pbi04621   NOD-like receptor signaling pathway pbi04625   C-type lectin receptor signaling pathway pbi04810   Regulation of actin cytoskeleton pbi05100   Bacterial invasion of epithelial cells pbi05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pbi00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     103049329 (RHOA)    04350 TGF-beta signaling pathway     103049329 (RHOA)    04150 mTOR signaling pathway     103049329 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     103049329 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103049329 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     103049329 (RHOA)    04520 Adherens junction     103049329 (RHOA)    04530 Tight junction     103049329 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103049329 (RHOA)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     103049329 (RHOA)    04625 C-type lectin receptor signaling pathway     103049329 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     103049329 (RHOA)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103049329 (RHOA)    05100 Bacterial invasion of epithelial cells     103049329 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pbi04131]     103049329 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pbi04147]     103049329 (RHOA)    04031 GTP-binding proteins [BR:pbi04031]     103049329 (RHOA) Membrane trafficking [BR:pbi04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     103049329 (RHOA) Exosome [BR:pbi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103049329 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    103049329 (RHOA)   Exosomal proteins of colorectal cancer cells    103049329 (RHOA)   Exosomal proteins of bladder cancer cells    103049329 (RHOA) GTP-binding proteins [BR:pbi04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     103049329 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  103049329 NCBI-ProteinID:  XP_007425866 UniProt:  A0A9F2KV61 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccattcggaaaaaactggttatagttggtgatggtgcctgtggcaagacatgt ctgctgattgtgtttagtaaagaccagttccctgaagtttatgttcctacagtatttgaa aactatgtagcagatattgaagttgatggaaagcaggtggagctggccttatgggataca gctggacaagaagactatgaccgacttaggccactttcatatccagacaccgatgttata cttatgtgtttttcaattgatagtcctgatagtttagaaaacattccagagaagtggact ccagaggtgaaacacttctgccccaatgtacccatcattctggtaggaaataagaaggat ttgaggaatgacgaacacacaagacgggagttggctaaaatgaagcaggaaccagtcaag cctgaagaaggtagagatatggcaaatcgcattggtgcttttggatacatggaatgcagt gcaaagaccaaagacggtgtgagggaagtttttgaaatggctactagagctgctttacaa gcccggcgtggcaagaaaaaatctgggtgccttctgttgtaa

DBGET integrated database retrieval system