Python bivittatus (Burmese python): 103050122 Help Entry 103050122         CDS       T03091                                  Symbol HMGB1 Name (RefSeq) high mobility group protein B1   KO K10802   high mobility group protein B1 Organism pbi  Python bivittatus (Burmese python) Pathway pbi03410   Base excision repair pbi04140   Autophagy - animal pbi04217   Necroptosis Brite KEGG Orthology (KO) [BR:pbi00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     103050122 (HMGB1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103050122 (HMGB1)   09143 Cell growth and death    04217 Necroptosis     103050122 (HMGB1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pbi03036]     103050122 (HMGB1)    03400 DNA repair and recombination proteins [BR:pbi03400]     103050122 (HMGB1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pbi04147]     103050122 (HMGB1) Chromosome and associated proteins [BR:pbi03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     103050122 (HMGB1) DNA repair and recombination proteins [BR:pbi03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      103050122 (HMGB1)    MMR (mismatch excision repair)     Other MMR factors      103050122 (HMGB1) Exosome [BR:pbi04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    103050122 (HMGB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HMG_box_2 HMG_box HMG_WDHD1 RNA_pol_3_Rpc31 HMG_box_5 DUF4667 NOA36 Motif Other DBs NCBI-GeneID:  103050122 NCBI-ProteinID:  XP_007424427 UniProt:  A0A9F2N3T8 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MGKGDPKKPRGKMSSYAYFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF EDMARADKVRYEREMKSYVPPKGESKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL SIGDVAKKLGEMWNNTSAEDKQPFEKKAAKLKEKYEKDIAAYRAKGKPDAAKKVAPKPEK SKKKKEEEDDDEEDEEEEEEEEEEEEEEEEEEDDE NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgggcaaaggtgatcctaaaaagccaagaggtaaaatgtcctcatatgcctattttgtg caaacctgccgggaagagcacaagaagaaacacccagatgcttcagtgaacttctcagag ttctcaaagaaatgttcagaaaggtggaagactatgtctgctaaggaaaaggggaaattt gaagatatggcacgagctgacaaagttcgttatgaaagagaaatgaaaagttatgtaccc cccaaaggagagtcaaaaaagaagttcaaggatccaaatgcaccaaagaggcctccttca gcatttttcttattttgctctgagtatcgtccaaaaatcaaaggagaacatcctggtctt tctattggggatgttgcaaagaaacttggagagatgtggaataatacatctgcagaggat aagcagccctttgaaaagaaggctgctaaactgaaggagaaatatgaaaaggatattgct gcataccgagctaagggaaagcctgatgcagccaaaaaggtagctcctaagcctgaaaaa agcaagaaaaagaaagaagaggaagatgatgatgaggaagatgaggaggaggaggaggaa gaagaggaagaagaagaggaggaggaggaggaggaagatgatgaataa

DBGET integrated database retrieval system