Python bivittatus (Burmese python): 103061779 Help Entry 103061779         CDS       T03091                                  Symbol CDO1 Name (RefSeq) cysteine dioxygenase type 1   KO K00456   cysteine dioxygenase [EC:1.13.11.20] Organism pbi  Python bivittatus (Burmese python) Pathway pbi00270   Cysteine and methionine metabolism pbi00430   Taurine and hypotaurine metabolism pbi01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:pbi00001]  09100 Metabolism   09105 Amino acid metabolism    00270 Cysteine and methionine metabolism     103061779 (CDO1)   09106 Metabolism of other amino acids    00430 Taurine and hypotaurine metabolism     103061779 (CDO1) Enzymes [BR:pbi01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.20  cysteine dioxygenase      103061779 (CDO1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CDO_I PCO_ADO Motif Other DBs NCBI-GeneID:  103061779 NCBI-ProteinID:  XP_007442153 UniProt:  A0A9F2RCL4 LinkDB All DBs Position Unknown AA seq 124 aa AA seqDB search NLYFCSSIHDHTSSHCFMKLLQGNLKETLFEWPGKKGVGEMLKKSERVLKRNQCAYINDS IGLHRVENPSHTETAVSLHLYSPPFETCQTFDQRTGHKQKVKMTFYSQFGERTPYTSAVS QENN NT seq 375 nt NT seq  +upstreamnt  +downstreamnt aatctctatttctgtagcagtatccatgaccacacaagttcacactgctttatgaaactc cttcaaggaaacctaaaggaaactttgtttgagtggcctggcaaaaagggagttggagag atgctgaaaaagtcagaaagggtgttaaagagaaatcaatgtgcctatattaatgactcc attggtttgcatcgtgtggagaacccaagccatactgaaacggctgttagtctccacttg tacagtccaccatttgaaacctgccagacctttgatcaaagaactgggcacaagcaaaaa gttaaaatgacgttctatagtcagtttggagaaaggactccttatacttcagcagtttct caagagaacaactga

DBGET integrated database retrieval system