Python bivittatus (Burmese python): 103063030 Help Entry 103063030         CDS       T03091                                  Symbol PFN2 Name (RefSeq) profilin-2   KO K05759   profilin Organism pbi  Python bivittatus (Burmese python) Pathway pbi04810   Regulation of actin cytoskeleton pbi05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pbi00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     103063030 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103063030 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pbi04131]     103063030 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pbi04812]     103063030 (PFN2)    04147 Exosome [BR:pbi04147]     103063030 (PFN2) Membrane trafficking [BR:pbi04131]  Others   Actin-binding proteins    Others     103063030 (PFN2) Cytoskeleton proteins [BR:pbi04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      103063030 (PFN2) Exosome [BR:pbi04147]  Exosomal proteins   Proteins found in most exosomes    103063030 (PFN2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  103063030 NCBI-ProteinID:  XP_007431551 UniProt:  A0A9F2QZG4 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGIFHSITPIEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggcaggctggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgtgacgccaagtacgtctgggcagcgacggccgggggcatcttt cacagcattacgcctatagaaatagatatgattgtaggaaaagaccgcgagggttttttt accaacggtctgactcttggtgcaaagaagtgttctgtgatcagagatagcctgtatgtg gatggtgactgtacaatggacatcaggacaaagagccaaggtggcgaaccaacatataat gttgctgtaggcagagctggacgagtcttggtctttgtaatgggcaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system