Python bivittatus (Burmese python): 103064488 Help Entry 103064488         CDS       T03091                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism pbi  Python bivittatus (Burmese python) Pathway pbi04020   Calcium signaling pathway pbi04070   Phosphatidylinositol signaling system pbi04114   Oocyte meiosis pbi04218   Cellular senescence pbi04261   Adrenergic signaling in cardiomyocytes pbi04270   Vascular smooth muscle contraction pbi04371   Apelin signaling pathway pbi04625   C-type lectin receptor signaling pathway pbi04744   Phototransduction pbi04910   Insulin signaling pathway pbi04912   GnRH signaling pathway pbi04916   Melanogenesis Brite KEGG Orthology (KO) [BR:pbi00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     103064488    04020 Calcium signaling pathway     103064488    04070 Phosphatidylinositol signaling system     103064488  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     103064488    04218 Cellular senescence     103064488  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103064488   09152 Endocrine system    04910 Insulin signaling pathway     103064488    04912 GnRH signaling pathway     103064488    04916 Melanogenesis     103064488   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     103064488    04270 Vascular smooth muscle contraction     103064488   09157 Sensory system    04744 Phototransduction     103064488  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pbi01009]     103064488   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pbi04131]     103064488    03036 Chromosome and associated proteins [BR:pbi03036]     103064488   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pbi04147]     103064488 Protein phosphatases and associated proteins [BR:pbi01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      103064488 Membrane trafficking [BR:pbi04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     103064488 Chromosome and associated proteins [BR:pbi03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      103064488 Exosome [BR:pbi04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    103064488 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 AIF-1 EH EFhand_Ca_insen EF-hand_11 EF_EFCAB10_C SPARC_Ca_bdg DUF1103 DUF5580_M Dockerin_1 SPEF2_C FCaBP_EF-hand SurA_N_3 Poly_export SurA_N_2 Motif Other DBs NCBI-GeneID:  103064488 NCBI-ProteinID:  XP_007441145 UniProt:  A0A9F3W0W2 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKD GNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgcgctccctgggtcagaaccccactgaggcagagttgcaagacatgatcaatgaagtg gatgcagatggaaatggcacaattgatttcccagaattcctcaccatgatggcccggaaa atgaaggacacagacagcgaagaagagatccgcgaggccttccgagtttttgacaaggat ggcaacgggtacattagtgctgcagagctgcgccacgttatgaccaaccttggcgagaag ctgacggatgaggaggtggatgaaatgatcagagaagcggatatagacggggatgggcaa gtcaattatgaagagtttgtacagatgatgaccgccaaataa

DBGET integrated database retrieval system