Python bivittatus (Burmese python): 103066291 Help Entry 103066291         CDS       T03091                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism pbi  Python bivittatus (Burmese python) Pathway pbi04010   MAPK signaling pathway pbi04012   ErbB signaling pathway pbi04068   FoxO signaling pathway pbi04137   Mitophagy - animal pbi04140   Autophagy - animal pbi04150   mTOR signaling pathway pbi04210   Apoptosis pbi04218   Cellular senescence pbi04370   VEGF signaling pathway pbi04371   Apelin signaling pathway pbi04540   Gap junction pbi04625   C-type lectin receptor signaling pathway pbi04810   Regulation of actin cytoskeleton pbi04910   Insulin signaling pathway pbi04912   GnRH signaling pathway pbi04916   Melanogenesis Brite KEGG Orthology (KO) [BR:pbi00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103066291 (NRAS)    04012 ErbB signaling pathway     103066291 (NRAS)    04370 VEGF signaling pathway     103066291 (NRAS)    04371 Apelin signaling pathway     103066291 (NRAS)    04068 FoxO signaling pathway     103066291 (NRAS)    04150 mTOR signaling pathway     103066291 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103066291 (NRAS)    04137 Mitophagy - animal     103066291 (NRAS)   09143 Cell growth and death    04210 Apoptosis     103066291 (NRAS)    04218 Cellular senescence     103066291 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     103066291 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103066291 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103066291 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     103066291 (NRAS)    04912 GnRH signaling pathway     103066291 (NRAS)    04916 Melanogenesis     103066291 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pbi04131]     103066291 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pbi04147]     103066291 (NRAS)    04031 GTP-binding proteins [BR:pbi04031]     103066291 (NRAS) Membrane trafficking [BR:pbi04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     103066291 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     103066291 (NRAS) Exosome [BR:pbi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103066291 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    103066291 (NRAS)   Exosomal proteins of breast cancer cells    103066291 (NRAS)   Exosomal proteins of colorectal cancer cells    103066291 (NRAS) GTP-binding proteins [BR:pbi04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     103066291 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  103066291 NCBI-ProteinID:  XP_007429935 UniProt:  A0A9F2QXJ3 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSEDVPMVLVGNKCDL PTRTVDTKQAHEVAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKRLNSNDDGNQG CMGVSCLVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaagctggtggtggtaggagctggtggtgttggaaaaagtgccctgacg atccagcttattcagaatcactttgtggatgaatatgatcctactattgaggattcttat cgtaaacaagtagttattgatggagagacttgtttgctagacatcctggacacagcaggg caggaggaatatagtgccatgagggaccaatatatgaggactggtgaaggctttctttgt gtgtttgccattaacaacagcaaatcatttgcagatataaatctttacagagagcaaatt aaaagagtgaaagattcagaagatgtaccaatggtattagtgggaaacaaatgtgatttg ccaacacggacagtagacaccaaacaggctcatgaagtagcaaagagctatggtattccc ttcattgagacatctgccaaaacaagacagggtgttgaagatgctttttacacactggtg agagagatccgtcagtatcgaatgaaaaggctcaacagcaatgacgatgggaatcaaggc tgcatgggggtctcgtgccttgtgatgtga

DBGET integrated database retrieval system