Python bivittatus (Burmese python): 112541766 Help Entry 112541766         CDS       T03091                                  Symbol CXCL13 Name (RefSeq) C-X-C motif chemokine 13   KO K10030   interleukin 8 Organism pbi  Python bivittatus (Burmese python) Pathway pbi04060   Cytokine-cytokine receptor interaction pbi04218   Cellular senescence pbi04620   Toll-like receptor signaling pathway pbi04621   NOD-like receptor signaling pathway pbi04622   RIG-I-like receptor signaling pathway pbi05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pbi00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112541766 (CXCL13)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     112541766 (CXCL13)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112541766 (CXCL13)    04621 NOD-like receptor signaling pathway     112541766 (CXCL13)    04622 RIG-I-like receptor signaling pathway     112541766 (CXCL13)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112541766 (CXCL13)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pbi04052]     112541766 (CXCL13)    00536 Glycosaminoglycan binding proteins [BR:pbi00536]     112541766 (CXCL13) Cytokines and neuropeptides [BR:pbi04052]  Cytokines   Chemokines    112541766 (CXCL13) Glycosaminoglycan binding proteins [BR:pbi00536]  Heparan sulfate / Heparin   Chemokines    112541766 (CXCL13) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  112541766 NCBI-ProteinID:  XP_025028421 UniProt:  A0A9F5J2S4 LinkDB All DBs Position Unknown AA seq 123 aa AA seqDB search MKSLILILTVALVASNINHIYGLAMEGHIAHLGRCKCLKHIALPFAPTQVKHIEVIPQRI HCRRMEIILTLKNSWKYCIHPNTPWVTALLKKWTKRLWLQPSLRVSFPASADQPHHFIKL DHP NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgaagagcctgattttgatactaacggtggccctagtagccagcaacatcaaccacatc tatggtcttgcaatggaagggcatatcgctcacttgggaagatgcaagtgcttaaagcac atagcattgccgtttgctccaacacaagtgaaacacattgaagtcattccccaaagaata cactgccgaaggatggagattatattaactctgaagaacagctggaaatactgcatccac cctaatactccttgggtgactgcattacttaagaagtggacaaagaggttatggcttcag cctagtctcagagtgtcttttcctgcctcagctgaccagccccatcactttatcaagcta gatcacccatga

DBGET integrated database retrieval system