Python bivittatus (Burmese python): YP_008083607 Help Entry YP_008083607      CDS       T03091                                  Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism pbi  Python bivittatus (Burmese python) Pathway pbi00190   Oxidative phosphorylation pbi01100   Metabolic pathways Module pbi_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:pbi00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     YP_008083607  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:pbi03029]     YP_008083607 Enzymes [BR:pbi01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      YP_008083607 Mitochondrial biogenesis [BR:pbi03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     YP_008083607 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Oxidored_q2 DUF8051 DUF7807 Motif Other DBs NCBI-ProteinID:  YP_008083607 UniProt:  R9UBG8 LinkDB All DBs Position MT AA seq 96 aa AA seqDB search MEPIKITLTTTFFIIMLGLSTQHKHLMLALMCIEAMMLTLFTMLVTYTATSLAVSHTPMP IILLTISVCGASLGLSLVVATTRTHGSDFLKNLNLL NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggaacccatcaaaatcacactaacaacaacattcttcattattatattaggtctatca acacaacacaaacacctaatactagcccttatatgtattgaagcaataatattgacccta tttactatactagtaacttacaccgcaacctcactagccgtatcccacaccccaataccc atcatcctactaacaatctcagtctgcggagcctccttaggactcagccttgtagtcgca accacccgaacacacggaagcgacttcctaaaaaacctaaatctactataa

DBGET integrated database retrieval system