Paraclostridium bifermentans: KXZ80_08660 Help Entry KXZ80_08660       CDS       T07479                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pbif  Paraclostridium bifermentans Pathway pbif00020   Citrate cycle (TCA cycle) pbif00720   Other carbon fixation pathways pbif01100   Metabolic pathways pbif01110   Biosynthesis of secondary metabolites pbif01120   Microbial metabolism in diverse environments pbif01200   Carbon metabolism pbif01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:pbif00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     KXZ80_08660   09102 Energy metabolism    00720 Other carbon fixation pathways     KXZ80_08660 Enzymes [BR:pbif01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      KXZ80_08660 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Fer4 Fer4_2 Fer4_7 Fer4_9 Fer4_6 Fer4_10 Fer4_21 Fer4_16 Fer4_8 Fer4_4 Fer4_17 Fer4_3 Fer4_15 Fer4_22 LdpA_Fe-S-bd Fer4_13 C1-like_CT Motif Other DBs NCBI-ProteinID:  UAG16859 LinkDB All DBs Position complement(1794267..1794464) Genome browser AA seq 65 aa AA seqDB search MEKGKLTIDTNWCKGCGICVEYCPKKVLKLENNIISVEDIEKCILCGLCELRCPDYAIYI SKDEK NT seq 198 nt NT seq  +upstreamnt  +downstreamnt ttggaaaaaggaaaacttacaatagatactaattggtgtaaaggttgcggtatttgtgta gaatactgtcctaaaaaagttttaaaattagagaacaatataatctctgtagaagatata gaaaaatgtatactttgtggattatgtgaacttagatgtccagattatgctatttatata tctaaggatgaaaaataa

DBGET integrated database retrieval system