Prevotella bivia: QP022_03080 Help Entry QP022_03080       CDS       T09089                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pbiv  Prevotella bivia Pathway pbiv01100   Metabolic pathways pbiv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pbiv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QP022_03080    00074 Mycolic acid biosynthesis     QP022_03080   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QP022_03080 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L50 Ribosomal_L12_N DUF1493 DUF2624 Motif Other DBs NCBI-ProteinID:  WIL17276 LinkDB All DBs Position 1:complement(705883..706119) Genome browser AA seq 78 aa AA seqDB search MSEIESKVKAIIVDKLGVDEAQVKAEASFTNDLGADSLDTVELIMEFEKEFGISIPDEQA EKIATVGDAISYIEANAK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtcagaaattgaatcaaaagtaaaggctattattgtagacaaactaggtgtagacgaa gcacaagtaaaggcagaagctagcttcacaaatgatcttggtgcagactctttggacact gtagagctaattatggaattcgaaaaggaattcggtatctctattccagacgagcaagct gagaagattgctacagttggcgatgctatatcttacattgaggctaacgcaaagtaa

DBGET integrated database retrieval system