Prevotella bivia: QP022_05500 Help Entry QP022_05500       CDS       T09089                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pbiv  Prevotella bivia Pathway pbiv00020   Citrate cycle (TCA cycle) pbiv00720   Other carbon fixation pathways pbiv01100   Metabolic pathways pbiv01110   Biosynthesis of secondary metabolites pbiv01120   Microbial metabolism in diverse environments pbiv01200   Carbon metabolism pbiv01210   2-Oxocarboxylic acid metabolism Module pbiv_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:pbiv00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     QP022_05500   09102 Energy metabolism    00720 Other carbon fixation pathways     QP022_05500 Enzymes [BR:pbiv01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      QP022_05500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_2 Fer4_21 Fer4_6 Fer4_7 Fer4_10 Fer4_9 Fer4_16 Fer4_4 Fer4_17 Fer4_8 Fer4_3 Chordopox_G2 Fer4_13 Motif Other DBs NCBI-ProteinID:  WIL17702 LinkDB All DBs Position 1:1261960..1262193 Genome browser AA seq 77 aa AA seqDB search MSKMKGAIVIDTDRCKGCQLCLVACPKDVIAVVKKKVNAHGYAYMVSERPDDCIGCTTCA VVCPDGCITVYRKKVEE NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaagatgaaaggtgctatcgtaatcgatactgaccgctgtaaaggttgtcagctc tgtcttgtggcttgtcctaaagatgtcattgcggtagttaagaaaaaagtgaatgcgcat ggttatgcatacatggtttcggagaggccagatgattgcataggttgcacaacgtgtgct gtggtgtgtccagatggttgtatcacagtttatagaaaaaaagtggaggaatga

DBGET integrated database retrieval system