Desulfobaculum bizertense: LWC08_09340 Help Entry LWC08_09340       CDS       T07819                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pbiz  Desulfobaculum bizertense Pathway pbiz00020   Citrate cycle (TCA cycle) pbiz00720   Other carbon fixation pathways pbiz01100   Metabolic pathways pbiz01110   Biosynthesis of secondary metabolites pbiz01120   Microbial metabolism in diverse environments pbiz01200   Carbon metabolism pbiz01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:pbiz00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     LWC08_09340   09102 Energy metabolism    00720 Other carbon fixation pathways     LWC08_09340 Enzymes [BR:pbiz01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      LWC08_09340 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_21 Fer4_4 Fer4_10 Fer4_9 Fer4_2 Fer4_8 Fer4_6 Fer4_16 Fer4_17 LdpA_Fe-S-bd Fer4_13 Fer4_3 Motif Other DBs NCBI-ProteinID:  UIJ36941 LinkDB All DBs Position 2004442..2004705 Genome browser AA seq 87 aa AA seqDB search MAKPKKGQTTITVYPDWCKACGLCVAFCPGKVLELDTVAGCARVVREEECINCGFCELHC PDFAIVVTPKAHAAEQNAPKKEAGGSQ NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggccaaacccaagaaaggacaaactaccatcaccgtgtaccccgactggtgcaaggca tgtgggctgtgtgtcgcattctgtcccggaaaggtgcttgagctcgacaccgttgctgga tgtgctcgagtggtgcgggaagaggaatgtatcaactgtggcttttgcgagctgcactgc ccagacttcgcaatcgttgtgacgcccaaagcacacgctgctgaacagaacgcgcccaaa aaagaggcaggaggcagtcaatga

DBGET integrated database retrieval system