Paenibacillus baekrokdamisoli: Back11_49670 Help Entry Back11_49670      CDS       T06671                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism pbk  Paenibacillus baekrokdamisoli Pathway pbk03060   Protein export pbk03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:pbk00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     Back11_49670  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     Back11_49670  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:pbk02044]     Back11_49670 Secretion system [BR:pbk02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    Back11_49670 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  BBH23622 UniProt:  A0A3G9IZB8 LinkDB All DBs Position 5598685..5598945 Genome browser AA seq 86 aa AA seqDB search MPHFSSSTIILLIIAALLLFGPNRLPELGRAIGKTFREFKNGTKELIEDPSPEPLSPQRK EVRADETNNLELNPLALSESKPEARG NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgccgcatttcagctcttcaacgattattttattaattattgccgcattgctcttgttt ggccctaataggctccccgaattgggacgggcgatcggcaaaacgtttcgggaattcaag aacgggacgaaggaattgatcgaggacccttcgcctgagcccctgtccccgcaacgaaaa gaggttcgagccgacgaaacgaataatctcgaactgaatcccttggcgttatcggaatct aaacccgaagcgcgagggtga

DBGET integrated database retrieval system