Paracoccidioides lutzii Pb01: PAAG_07510 Help Entry PAAG_07510        CDS       T02230                                  Name (RefSeq) hypothetical protein   KO K03017   DNA-directed RNA polymerase II subunit RPB9 Organism pbl  Paracoccidioides lutzii Pb01 Pathway pbl03020   RNA polymerase pbl03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:pbl00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     PAAG_07510   09124 Replication and repair    03420 Nucleotide excision repair     PAAG_07510  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:pbl03021]     PAAG_07510    03400 DNA repair and recombination proteins [BR:pbl03400]     PAAG_07510 Transcription machinery [BR:pbl03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol II specific subunits      PAAG_07510 DNA repair and recombination proteins [BR:pbl03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       PAAG_07510 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Zn_ribbon_RPB9 GFA C1_1 DUF7577 Motif Other DBs NCBI-GeneID:  9093869 NCBI-ProteinID:  XP_002790651 UniProt:  C1H9R9 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search MSSPSSSNGDDQSQNVGQIHFRFCRECSNLLYPKEDRASNKLMYTCRTCHVGEPATSPCV FQNKLNTQVGDTAGVTQDVGSDPTVGFPLCTLCGEEIEE NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgtcttcccctagctcctccaacggtgacgaccagtcccagaacgtcggtcaaatccat ttccgcttctgtcgtgaatgttccaacctcctctacccaaaagaagaccgcgcctccaac aaactcatgtacacctgccgaacctgccacgtcggcgaaccggctacgtccccctgcgtc ttccagaacaagctcaatacccaagtcggcgatacggctggcgtgactcaggatgtggga tcggatcctacggttggttttcccttgtgtactttgtgcggagaggagattgaggagtag

DBGET integrated database retrieval system