Paracoccidioides lutzii Pb01: PAAG_08012 Help Entry PAAG_08012        CDS       T02230                                  Name (RefSeq) Microtubule associated protein   KO K08341   GABA(A) receptor-associated protein Organism pbl  Paracoccidioides lutzii Pb01 Pathway pbl04136   Autophagy - other pbl04138   Autophagy - yeast pbl04139   Mitophagy - yeast Brite KEGG Orthology (KO) [BR:pbl00001]  09140 Cellular Processes   09141 Transport and catabolism    04138 Autophagy - yeast     PAAG_08012    04136 Autophagy - other     PAAG_08012    04139 Mitophagy - yeast     PAAG_08012  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pbl04131]     PAAG_08012    04121 Ubiquitin system [BR:pbl04121]     PAAG_08012    03029 Mitochondrial biogenesis [BR:pbl03029]     PAAG_08012 Membrane trafficking [BR:pbl04131]  Autophagy   Autophagosome formation proteins    Atg8 conjugation proteins     PAAG_08012 Ubiquitin system [BR:pbl04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    PAAG_08012 Mitochondrial biogenesis [BR:pbl03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     PAAG_08012 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ATG8 APG12 Hanta_Gn-B Motif Other DBs NCBI-GeneID:  9093335 NCBI-ProteinID:  XP_002790126 UniProt:  C1HB71 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MRSKFKDEHPFEKRKAEAERIRAKYADRIPVICEKVEKSDIATIDKKKYLVPADLTVGQF VYVIRKRIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGEC NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atgcgttccaagttcaaggacgagcatccatttgagaagcgcaaggcggaagccgagcgc attcgagcgaaatatgcagaccgtatcccggttatctgtgagaaagtcgagaaatccgat atcgcaaccatcgacaagaagaagtatcttgtccccgcagatctcaccgtcggccagttt gtctacgtcatccgcaaacgcatcaagctttctcccgaaaaggccattttcatcttcgtc gatgaggttctccctcccacagccgctctgatgagcagcatctatgaagagcacaaggat gaggacggtttcctatacatcacatactcgggcgagaacacattcggagaatgttaa

DBGET integrated database retrieval system