Stutzerimonas balearica: CL52_01225 Help Entry CL52_01225        CDS       T03573                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism pbm  Stutzerimonas balearica Brite KEGG Orthology (KO) [BR:pbm00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pbm03036]     CL52_01225 Chromosome and associated proteins [BR:pbm03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     CL52_01225 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB USHBP1_PDZ-bd Matrilin_ccoil Macoilin DivIC YabA Motif Other DBs NCBI-ProteinID:  AJE13728 UniProt:  A0A8D3XXX6 LinkDB All DBs Position complement(273708..273917) Genome browser AA seq 69 aa AA seqDB search MEDADLRLLTAKLEQLIQRIEQLKAQNRLLQANEQAWREERAHLIEKNEMARLKVESMIS RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagacgccgatctgcgattgctgaccgccaagctcgagcagctgatccagcgcatc gagcaactcaaggcccagaatcgcctgctgcaggcgaacgagcaggcctggcgcgaggag cgcgctcatctgatcgaaaagaacgaaatggcccggttgaaggtcgaatcgatgatttcg cgcctgaaagccctggagcaggactcatga

DBGET integrated database retrieval system