Stutzerimonas balearica: CL52_12895 Help Entry CL52_12895        CDS       T03573                                  Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism pbm  Stutzerimonas balearica Brite KEGG Orthology (KO) [BR:pbm00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pbm03036]     CL52_12895 Chromosome and associated proteins [BR:pbm03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     CL52_12895 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC Sipho_Gp157 YabA ACCA_BT ZapB NRBF2 Noelin-1 Motif Other DBs NCBI-ProteinID:  AJE15886 UniProt:  A0A8D3Y2W1 LinkDB All DBs Position complement(2784974..2785252) Genome browser AA seq 92 aa AA seqDB search MRSPYWLFVVLILLLGGLQYRLWVGEGSLAQISSLNKQIEEQQGENKRLLERNRILEAEV MELKQGMETVEERARHELGMVKEGETLYQLTE NT seq 279 nt NT seq  +upstreamnt  +downstreamnt ttgcgtagcccatactggctgttcgtcgtgctgatcctgctgctgggcggtctgcagtac cgcttgtgggtgggcgaagggagcctggcgcagatcagcagcctcaacaagcagatcgag gagcagcaaggcgagaacaagcgcctgctcgagcgcaatcgcatcctcgaggccgaggtg atggagctcaaacagggcatggaaaccgtcgaggagcgtgcccgccatgagctgggcatg gtcaaggaaggcgaaaccctctaccagctcaccgaatga

DBGET integrated database retrieval system