Paracoccidioides brasiliensis: PADG_00252 Help Entry PADG_00252        CDS       T03549                                  Name (RefSeq) uncharacterized protein   KO K00052   3-isopropylmalate dehydrogenase [EC:1.1.1.85] Organism pbn  Paracoccidioides brasiliensis Pathway pbn00290   Valine, leucine and isoleucine biosynthesis pbn00660   C5-Branched dibasic acid metabolism pbn01100   Metabolic pathways pbn01110   Biosynthesis of secondary metabolites pbn01210   2-Oxocarboxylic acid metabolism pbn01230   Biosynthesis of amino acids Module pbn_M00432   Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate Brite KEGG Orthology (KO) [BR:pbn00001]  09100 Metabolism   09101 Carbohydrate metabolism    00660 C5-Branched dibasic acid metabolism     PADG_00252   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     PADG_00252 Enzymes [BR:pbn01000]  1. Oxidoreductases   1.1  Acting on the CH-OH group of donors    1.1.1  With NAD+ or NADP+ as acceptor     1.1.1.85  3-isopropylmalate dehydrogenase      PADG_00252 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Iso_dh Motif Other DBs NCBI-GeneID:  22580124 NCBI-ProteinID:  XP_010756271 UniProt:  C1G062 LinkDB All DBs Position Unknown AA seq 83 aa AA seqDB search MPSKVLSAFSSQKHTFDLRNDLIGGCSIDTHGTPITKTVMQAALDSDAVLFASVGGPKWD GVRHGLEEQGYAMDEWGYSAPEV NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgccgtcaaaagtcctttccgctttctcttcgcaaaaacacacttttgacctccgcaac gacctaatcggtggctgcagcatcgacacccacggcaccccaataacaaagactgtcatg caggcagctctagactctgatgcggttctatttgcctccgtgggcgggcccaaatgggac ggtgtccgacacggcctggaggagcagggctatgcaatggacgaatggggttacagcgcc cctgaagtgtga

DBGET integrated database retrieval system