Paraburkholderia bonniea: QS306_10235 Help Entry QS306_10235       CDS       T09664                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pbon  Paraburkholderia bonniea Pathway pbon00998   Biosynthesis of various antibiotics pbon01100   Metabolic pathways pbon01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pbon00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QS306_10235 (acpP)    00074 Mycolic acid biosynthesis     QS306_10235 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QS306_10235 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  WJF89493 LinkDB All DBs Position 1:complement(2348929..2349168) Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacagcgcgtcaagaaaatcgttgcagaacaactgggcgtagccgag gcagagatcaagaacgaggcttcgttcgtgaacgatctgggcgctgattcgctcgatacc gtcgaactcgtaatggcgctcgaagacgaattcggcatggaaattcctgacgaagaagct gagaaaattaccacggtgcaacaggctatcgactacgctcgcgctaacgtcaaggcctaa

DBGET integrated database retrieval system