Paludisphaera borealis: BSF38_02696 Help Entry BSF38_02696       CDS       T04622                                  Symbol acpP_4 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism pbor  Paludisphaera borealis Pathway pbor01100   Metabolic pathways pbor01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pbor00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BSF38_02696 (acpP_4)    00074 Mycolic acid biosynthesis     BSF38_02696 (acpP_4)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BSF38_02696 (acpP_4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 Ribosomal_L12_N UBA_2 DUF1409 Motif Other DBs NCBI-ProteinID:  APW61192 UniProt:  A0A1U7CQI3 LinkDB All DBs Position 3464809..3465051 Genome browser AA seq 80 aa AA seqDB search MSVEERVIEIVSEQMGVSKDQVSRETSFVNDLGADSLDTVELVMEFEEEFDITIPDEEAE KIQSVGQAIDYIEQHGHSAK NT seq 243 nt NT seq  +upstreamnt  +downstreamnt gtgtccgtggaagagcgcgtaatcgaaatcgtcagcgagcagatgggtgtctccaaggac caggtcagccgggagacgtccttcgtcaacgacctcggggccgattcgctcgacaccgtc gagctggtcatggagttcgaggaagagttcgacatcaccatccccgacgaggaggccgag aagattcagagcgtgggccaggccatcgactacatcgaacagcacggtcacagcgccaag tga

DBGET integrated database retrieval system