Paludisphaera borealis: BSF38_03101 Help Entry BSF38_03101       CDS       T04622                                  Name (GenBank) hypothetical protein   KO K03210   preprotein translocase subunit YajC Organism pbor  Paludisphaera borealis Pathway pbor02024   Quorum sensing pbor03060   Protein export pbor03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:pbor00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     BSF38_03101  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     BSF38_03101  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     BSF38_03101  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:pbor02044]     BSF38_03101 Secretion system [BR:pbor02044]  Sec (secretion) system   Prokaryotic Sec-SRP core components    BSF38_03101 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YajC MreC Vut_1 DUF1240 Motif Other DBs NCBI-ProteinID:  APW61583 UniProt:  A0A1U7CRS9 LinkDB All DBs Position 3958698..3959036 Genome browser AA seq 112 aa AA seqDB search MMPGLFDVIGPIFAQAAGNDNSWTGFLILLPIPVLFYFMIWLPQQQQEKKRRAMIDALKK NDKVVTIAGIFGTVTSVDPDQDKIVLRIDDDKGVKIGVTRASVARVLEPSSD NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atgatgcctggactgttcgacgtgatcgggccgatcttcgcccaagccgcggggaacgac aacagttggaccggcttcctgatcctgctgccgatccccgtcctcttctatttcatgatc tggctcccccagcagcagcaagagaagaagcggcgggcgatgatcgacgccctcaagaag aacgacaaggtggtcaccatcgcggggatcttcggcacggtgacctcggtcgaccccgac caggacaagatcgtcctgcggatcgacgacgacaagggggtcaagatcggcgtcacccgg gcgagcgtggcgcgcgtgctcgaaccgtcgtccgattga

DBGET integrated database retrieval system