Sedimentisphaera salicampi: STSP1_01849 Help Entry STSP1_01849       CDS       T05439                                  Name (GenBank) hypothetical protein   KO K03060   DNA-directed RNA polymerase subunit omega [EC:2.7.7.6] Organism pbp  Sedimentisphaera salicampi Pathway pbp03020   RNA polymerase Brite KEGG Orthology (KO) [BR:pbp00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     STSP1_01849  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:pbp03021]     STSP1_01849    03400 DNA repair and recombination proteins [BR:pbp03400]     STSP1_01849 Enzymes [BR:pbp01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.6  DNA-directed RNA polymerase      STSP1_01849 Transcription machinery [BR:pbp03021]  Prokaryotic type   Bacterial type    RNA polymerase     Core subunits      STSP1_01849 DNA repair and recombination proteins [BR:pbp03400]  Prokaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase complex (RNAP)       STSP1_01849 SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb6 DUF2023 Motif Other DBs NCBI-ProteinID:  ARN57442 UniProt:  A0A1W6LNY5 LinkDB All DBs Position 2466200..2466403 Genome browser AA seq 67 aa AA seqDB search MIEALKRDEIYRKVGGSFKLSALIQKRMRELMDGARPLIEDTVDKTMIEIVVEEILEDKI TYEIEED NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgattgaagcactgaaacgggatgaaatatatcgcaaggtaggcgggagctttaagctt tcagctcttattcagaagaggatgcgggagcttatggacggcgcccgcccgcttatcgag gatactgtagacaaaacaatgatagagatcgttgtggaggagatcctcgaagataaaatt acatacgagatagaagaagattag

DBGET integrated database retrieval system