Parvularcula bermudensis: PB2503_07459 Help Entry PB2503_07459      CDS       T01298                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pbr  Parvularcula bermudensis Pathway pbr01100   Metabolic pathways pbr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pbr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PB2503_07459    00074 Mycolic acid biosynthesis     PB2503_07459   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PB2503_07459 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ADM09549 UniProt:  E0TFE8 LinkDB All DBs Position complement(1463028..1463270) Genome browser AA seq 80 aa AA seqDB search MTRDELLNDVREIVASNIGVEAAEVTEQTSMENQELWDSVAHVDITFAIEEKYNIELGQE ETEQMSSVAEIMKVLEPKVS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacaagagatgaattgctgaacgacgtccgggaaatcgtcgcctccaatatcggggtc gaagcggctgaggtgaccgagcaaacatccatggaaaatcaagaactttgggattccgtg gcccatgtcgacatcaccttcgccatcgaagaaaaatacaatatcgaactcggtcaggaa gaaaccgagcaaatgtcgtcggttgccgaaatcatgaaggttctcgaaccgaaggtcagc taa

DBGET integrated database retrieval system