Parvularcula bermudensis: PB2503_07489 Help Entry PB2503_07489      CDS       T01298                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism pbr  Parvularcula bermudensis Pathway pbr01100   Metabolic pathways pbr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pbr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PB2503_07489    00074 Mycolic acid biosynthesis     PB2503_07489   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PB2503_07489 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ADM09555 UniProt:  E0TFF4 LinkDB All DBs Position 1478005..1478283 Genome browser AA seq 92 aa AA seqDB search MNSADIDRAVVGILERFTDDWGVDHQITPDSQIVADLEFESIDVIQLVVAIEQHFGIRNM GFDELLMKDGKYVDDLTVRQIADFINKKINGA NT seq 279 nt NT seq  +upstreamnt  +downstreamnt gtgaattccgctgatattgatcgcgccgtcgtcggcatcctggaacggtttaccgacgat tggggcgtcgaccatcagatcacccctgactcgcaaatcgtggccgatctcgaattcgag tcgatcgatgtgatccagctcgtggtcgccatcgagcagcatttcggcatccgcaatatg ggatttgatgaattgctgatgaaggacggcaaatatgtcgacgacctgaccgtccggcaa attgcggacttcattaacaaaaagatcaacggcgcctga

DBGET integrated database retrieval system