Parvularcula bermudensis: PB2503_08154 Help Entry PB2503_08154      CDS       T01298                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism pbr  Parvularcula bermudensis Brite KEGG Orthology (KO) [BR:pbr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pbr03032]     PB2503_08154    03036 Chromosome and associated proteins [BR:pbr03036]     PB2503_08154    03400 DNA repair and recombination proteins [BR:pbr03400]     PB2503_08154 DNA replication proteins [BR:pbr03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     PB2503_08154 Chromosome and associated proteins [BR:pbr03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     PB2503_08154 DNA repair and recombination proteins [BR:pbr03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       PB2503_08154 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  ADM09686 UniProt:  E0TIA2 LinkDB All DBs Position 1613801..1614088 Genome browser AA seq 95 aa AA seqDB search MSKAEFISNVAAAGDMSNAEAKRMVELVFGEIEAGLKRAKKDGKYTIGTFGTFTITKRPA RKGRNPRTGEEIKIKASKSLRFRPSSNLKAAAGIK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgagcaaagccgaattcatcagcaatgttgccgcagccggcgacatgtccaatgccgaa gccaaacgaatggtcgaacttgtctttggagagatcgaagcaggtctcaagcgagccaaa aaagacggcaagtatacgattgggacgtttgggacgtttacgatcaccaagcgcccggca cgcaaggggcgcaatcctcggaccggcgaagagatcaagatcaaggcatcgaaatctttg cggttccggccctcatccaatttgaaggcggccgccgggatcaagtaa

DBGET integrated database retrieval system