Parvularcula bermudensis: PB2503_11244 Help Entry PB2503_11244      CDS       T01298                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pbr  Parvularcula bermudensis Pathway pbr01100   Metabolic pathways pbr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pbr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PB2503_11244    00074 Mycolic acid biosynthesis     PB2503_11244   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PB2503_11244 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L12_N Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  ADM10296 UniProt:  E0TC38 LinkDB All DBs Position complement(2253037..2253276) Genome browser AA seq 79 aa AA seqDB search MADIAERVKKITTEHLDVDASKVEPSASFIDDLGADSLDIVELVMAFEEEFGIEIPDDAA ETIQTVGDAIKFIEEKNAG NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggcagacatcgccgagcgcgtgaaaaagattacgacggaacatctcgatgtagatgcg tccaaggtcgaaccaagtgccagcttcatcgacgatctcggcgcggacagcctcgacatc gtcgagctggtgatggcgttcgaagaggagttcgggatcgagattcccgacgatgcagcc gagaccattcagacggtcggcgacgccatcaagttcatcgaagagaagaatgcgggctga

DBGET integrated database retrieval system