Pseudomonas brenneri: QDY63_24075
Help
Entry
QDY63_24075 CDS
T10502
Name
(GenBank) FadR/GntR family transcriptional regulator
Organism
pbre Pseudomonas brenneri
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
FCD
GntR
HTH_41
HTH_20
TrmB
HTH_Crp_2
DUF5636
Sigma70_r3
HTH_24
Rrf2
HTH_11
HTH_IclR
DnaD_N
HTH_CodY
HTH_8
TFIIE_alpha
HTH_PafC
RepL
Motif
Other DBs
NCBI-ProteinID:
WJM90406
LinkDB
All DBs
Position
complement(5219306..5219965)
Genome browser
AA seq
219 aa
AA seq
DB search
MTDIAPLIKRSLVDQALDQLRQRITQGKWAIGERLPTEPELSAELGISRNTVREAMRVLA
FSGLIEIRQGDGSYLRSMTDPLGVMNAMSHCTLFQAQETRQILEVEAIGLAALRRTPEDL
RRLREALDASGEHYHGDLEHYIRCDLVFHKRLVDAAHNPALSELYQYFSSIVGAQLRQTL
NIKPRRQAVFDLHVELLEAVEQQDPERAKALSRQLINEP
NT seq
660 nt
NT seq
+upstream
nt +downstream
nt
atgacagacatcgctccgctgatcaaacgttccctggtcgaccaggccctggaccaactg
cgccagcgcatcacccaaggcaagtgggcgattggcgaacgcctgcccaccgagcccgag
ctgtctgccgagctgggcatcagccgcaacaccgtgcgcgaggccatgcgggtgctggcg
ttctcggggttgatcgagatccgccagggcgatggcagttacctgcgctcgatgaccgac
cccttgggggtaatgaacgccatgtctcattgcaccctgttccaggcccaggagacgcgg
cagattctcgaagtcgaggccattggcctggccgctttgcgccgaaccccagaagattta
cgacggttgcgcgaagcgttagacgccagcggcgagcactaccatggtgatctggagcac
tacatccgctgcgacctggtgttccacaagcgcttggtggatgccgctcacaacccggcc
ttgagcgagttgtaccaatacttttccagcatcgtcggcgcccagttgcgccagaccctg
aacatcaagccacgccgccaggcggtgttcgacctgcatgtcgagctgcttgaggccgtg
gagcaacaggacccggagcgcgccaaggcattgtcccggcagttgatcaatgaaccttga
DBGET
integrated database retrieval system