Pseudonocardia broussonetiae: HOP40_17495 Help Entry HOP40_17495       CDS       T07210                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pbro  Pseudonocardia broussonetiae Pathway pbro00998   Biosynthesis of various antibiotics pbro01100   Metabolic pathways pbro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pbro00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HOP40_17495    00074 Mycolic acid biosynthesis     HOP40_17495   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HOP40_17495 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  QJY47382 UniProt:  A0A6M6JL79 LinkDB All DBs Position complement(3541774..3542016) Genome browser AA seq 80 aa AA seqDB search MADKTEILAGLAEIVEEVAGIDTAEVDADKSFVDDLDIDSLSMVEIAVQAEDKFGVKIPD DQLAELKTVGDAVDYIAKNQ NT seq 243 nt NT seq  +upstreamnt  +downstreamnt gtggcagacaagaccgagatcctcgccggcctggccgagatcgtggaggaggtcgccggc atcgacaccgccgaggtcgacgccgacaagtccttcgtggacgacctcgacatcgactcg ctgtcgatggtggagatcgccgtgcaggccgaggacaagttcggcgtgaagatcccggac gaccagctggccgagctcaagacggtcggtgacgcggtggactacatcgcgaagaaccag tga

DBGET integrated database retrieval system