KEGG   Petaurus breviceps papuanus (sugar glider): 138171419
Entry
138171419         CDS       T10505                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pbrv  Petaurus breviceps papuanus (sugar glider)
Pathway
pbrv01521  EGFR tyrosine kinase inhibitor resistance
pbrv01522  Endocrine resistance
pbrv01524  Platinum drug resistance
pbrv04010  MAPK signaling pathway
pbrv04012  ErbB signaling pathway
pbrv04014  Ras signaling pathway
pbrv04015  Rap1 signaling pathway
pbrv04022  cGMP-PKG signaling pathway
pbrv04024  cAMP signaling pathway
pbrv04062  Chemokine signaling pathway
pbrv04066  HIF-1 signaling pathway
pbrv04068  FoxO signaling pathway
pbrv04071  Sphingolipid signaling pathway
pbrv04072  Phospholipase D signaling pathway
pbrv04114  Oocyte meiosis
pbrv04140  Autophagy - animal
pbrv04148  Efferocytosis
pbrv04150  mTOR signaling pathway
pbrv04151  PI3K-Akt signaling pathway
pbrv04210  Apoptosis
pbrv04218  Cellular senescence
pbrv04261  Adrenergic signaling in cardiomyocytes
pbrv04270  Vascular smooth muscle contraction
pbrv04350  TGF-beta signaling pathway
pbrv04360  Axon guidance
pbrv04370  VEGF signaling pathway
pbrv04371  Apelin signaling pathway
pbrv04380  Osteoclast differentiation
pbrv04510  Focal adhesion
pbrv04517  IgSF CAM signaling
pbrv04520  Adherens junction
pbrv04540  Gap junction
pbrv04550  Signaling pathways regulating pluripotency of stem cells
pbrv04611  Platelet activation
pbrv04613  Neutrophil extracellular trap formation
pbrv04620  Toll-like receptor signaling pathway
pbrv04621  NOD-like receptor signaling pathway
pbrv04625  C-type lectin receptor signaling pathway
pbrv04650  Natural killer cell mediated cytotoxicity
pbrv04657  IL-17 signaling pathway
pbrv04658  Th1 and Th2 cell differentiation
pbrv04659  Th17 cell differentiation
pbrv04660  T cell receptor signaling pathway
pbrv04662  B cell receptor signaling pathway
pbrv04664  Fc epsilon RI signaling pathway
pbrv04666  Fc gamma R-mediated phagocytosis
pbrv04668  TNF signaling pathway
pbrv04713  Circadian entrainment
pbrv04720  Long-term potentiation
pbrv04722  Neurotrophin signaling pathway
pbrv04723  Retrograde endocannabinoid signaling
pbrv04724  Glutamatergic synapse
pbrv04725  Cholinergic synapse
pbrv04726  Serotonergic synapse
pbrv04730  Long-term depression
pbrv04810  Regulation of actin cytoskeleton
pbrv04910  Insulin signaling pathway
pbrv04912  GnRH signaling pathway
pbrv04914  Progesterone-mediated oocyte maturation
pbrv04915  Estrogen signaling pathway
pbrv04916  Melanogenesis
pbrv04917  Prolactin signaling pathway
pbrv04919  Thyroid hormone signaling pathway
pbrv04921  Oxytocin signaling pathway
pbrv04926  Relaxin signaling pathway
pbrv04928  Parathyroid hormone synthesis, secretion and action
pbrv04929  GnRH secretion
pbrv04930  Type II diabetes mellitus
pbrv04933  AGE-RAGE signaling pathway in diabetic complications
pbrv04934  Cushing syndrome
pbrv04935  Growth hormone synthesis, secretion and action
pbrv04960  Aldosterone-regulated sodium reabsorption
pbrv05010  Alzheimer disease
pbrv05020  Prion disease
pbrv05022  Pathways of neurodegeneration - multiple diseases
pbrv05034  Alcoholism
pbrv05132  Salmonella infection
pbrv05133  Pertussis
pbrv05135  Yersinia infection
pbrv05140  Leishmaniasis
pbrv05142  Chagas disease
pbrv05145  Toxoplasmosis
pbrv05152  Tuberculosis
pbrv05160  Hepatitis C
pbrv05161  Hepatitis B
pbrv05163  Human cytomegalovirus infection
pbrv05164  Influenza A
pbrv05165  Human papillomavirus infection
pbrv05166  Human T-cell leukemia virus 1 infection
pbrv05167  Kaposi sarcoma-associated herpesvirus infection
pbrv05170  Human immunodeficiency virus 1 infection
pbrv05171  Coronavirus disease - COVID-19
pbrv05200  Pathways in cancer
pbrv05203  Viral carcinogenesis
pbrv05205  Proteoglycans in cancer
pbrv05206  MicroRNAs in cancer
pbrv05207  Chemical carcinogenesis - receptor activation
pbrv05208  Chemical carcinogenesis - reactive oxygen species
pbrv05210  Colorectal cancer
pbrv05211  Renal cell carcinoma
pbrv05212  Pancreatic cancer
pbrv05213  Endometrial cancer
pbrv05214  Glioma
pbrv05215  Prostate cancer
pbrv05216  Thyroid cancer
pbrv05218  Melanoma
pbrv05219  Bladder cancer
pbrv05220  Chronic myeloid leukemia
pbrv05221  Acute myeloid leukemia
pbrv05223  Non-small cell lung cancer
pbrv05224  Breast cancer
pbrv05225  Hepatocellular carcinoma
pbrv05226  Gastric cancer
pbrv05230  Central carbon metabolism in cancer
pbrv05231  Choline metabolism in cancer
pbrv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pbrv05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pbrv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    138171419 (MAPK1)
   04012 ErbB signaling pathway
    138171419 (MAPK1)
   04014 Ras signaling pathway
    138171419 (MAPK1)
   04015 Rap1 signaling pathway
    138171419 (MAPK1)
   04350 TGF-beta signaling pathway
    138171419 (MAPK1)
   04370 VEGF signaling pathway
    138171419 (MAPK1)
   04371 Apelin signaling pathway
    138171419 (MAPK1)
   04668 TNF signaling pathway
    138171419 (MAPK1)
   04066 HIF-1 signaling pathway
    138171419 (MAPK1)
   04068 FoxO signaling pathway
    138171419 (MAPK1)
   04072 Phospholipase D signaling pathway
    138171419 (MAPK1)
   04071 Sphingolipid signaling pathway
    138171419 (MAPK1)
   04024 cAMP signaling pathway
    138171419 (MAPK1)
   04022 cGMP-PKG signaling pathway
    138171419 (MAPK1)
   04151 PI3K-Akt signaling pathway
    138171419 (MAPK1)
   04150 mTOR signaling pathway
    138171419 (MAPK1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    138171419 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    138171419 (MAPK1)
   04148 Efferocytosis
    138171419 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    138171419 (MAPK1)
   04210 Apoptosis
    138171419 (MAPK1)
   04218 Cellular senescence
    138171419 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    138171419 (MAPK1)
   04520 Adherens junction
    138171419 (MAPK1)
   04540 Gap junction
    138171419 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    138171419 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    138171419 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    138171419 (MAPK1)
   04613 Neutrophil extracellular trap formation
    138171419 (MAPK1)
   04620 Toll-like receptor signaling pathway
    138171419 (MAPK1)
   04621 NOD-like receptor signaling pathway
    138171419 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    138171419 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    138171419 (MAPK1)
   04660 T cell receptor signaling pathway
    138171419 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    138171419 (MAPK1)
   04659 Th17 cell differentiation
    138171419 (MAPK1)
   04657 IL-17 signaling pathway
    138171419 (MAPK1)
   04662 B cell receptor signaling pathway
    138171419 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    138171419 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    138171419 (MAPK1)
   04062 Chemokine signaling pathway
    138171419 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    138171419 (MAPK1)
   04929 GnRH secretion
    138171419 (MAPK1)
   04912 GnRH signaling pathway
    138171419 (MAPK1)
   04915 Estrogen signaling pathway
    138171419 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    138171419 (MAPK1)
   04917 Prolactin signaling pathway
    138171419 (MAPK1)
   04921 Oxytocin signaling pathway
    138171419 (MAPK1)
   04926 Relaxin signaling pathway
    138171419 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    138171419 (MAPK1)
   04919 Thyroid hormone signaling pathway
    138171419 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    138171419 (MAPK1)
   04916 Melanogenesis
    138171419 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    138171419 (MAPK1)
   04270 Vascular smooth muscle contraction
    138171419 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    138171419 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    138171419 (MAPK1)
   04725 Cholinergic synapse
    138171419 (MAPK1)
   04726 Serotonergic synapse
    138171419 (MAPK1)
   04720 Long-term potentiation
    138171419 (MAPK1)
   04730 Long-term depression
    138171419 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    138171419 (MAPK1)
   04722 Neurotrophin signaling pathway
    138171419 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    138171419 (MAPK1)
   04380 Osteoclast differentiation
    138171419 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    138171419 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    138171419 (MAPK1)
   05206 MicroRNAs in cancer
    138171419 (MAPK1)
   05205 Proteoglycans in cancer
    138171419 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    138171419 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    138171419 (MAPK1)
   05203 Viral carcinogenesis
    138171419 (MAPK1)
   05230 Central carbon metabolism in cancer
    138171419 (MAPK1)
   05231 Choline metabolism in cancer
    138171419 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    138171419 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    138171419 (MAPK1)
   05212 Pancreatic cancer
    138171419 (MAPK1)
   05225 Hepatocellular carcinoma
    138171419 (MAPK1)
   05226 Gastric cancer
    138171419 (MAPK1)
   05214 Glioma
    138171419 (MAPK1)
   05216 Thyroid cancer
    138171419 (MAPK1)
   05221 Acute myeloid leukemia
    138171419 (MAPK1)
   05220 Chronic myeloid leukemia
    138171419 (MAPK1)
   05218 Melanoma
    138171419 (MAPK1)
   05211 Renal cell carcinoma
    138171419 (MAPK1)
   05219 Bladder cancer
    138171419 (MAPK1)
   05215 Prostate cancer
    138171419 (MAPK1)
   05213 Endometrial cancer
    138171419 (MAPK1)
   05224 Breast cancer
    138171419 (MAPK1)
   05223 Non-small cell lung cancer
    138171419 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    138171419 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    138171419 (MAPK1)
   05161 Hepatitis B
    138171419 (MAPK1)
   05160 Hepatitis C
    138171419 (MAPK1)
   05171 Coronavirus disease - COVID-19
    138171419 (MAPK1)
   05164 Influenza A
    138171419 (MAPK1)
   05163 Human cytomegalovirus infection
    138171419 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    138171419 (MAPK1)
   05165 Human papillomavirus infection
    138171419 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    138171419 (MAPK1)
   05135 Yersinia infection
    138171419 (MAPK1)
   05133 Pertussis
    138171419 (MAPK1)
   05152 Tuberculosis
    138171419 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    138171419 (MAPK1)
   05140 Leishmaniasis
    138171419 (MAPK1)
   05142 Chagas disease
    138171419 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    138171419 (MAPK1)
   05020 Prion disease
    138171419 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    138171419 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    138171419 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    138171419 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    138171419 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    138171419 (MAPK1)
   04934 Cushing syndrome
    138171419 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    138171419 (MAPK1)
   01524 Platinum drug resistance
    138171419 (MAPK1)
   01522 Endocrine resistance
    138171419 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pbrv01001]
    138171419 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pbrv03036]
    138171419 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pbrv04147]
    138171419 (MAPK1)
Enzymes [BR:pbrv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     138171419 (MAPK1)
Protein kinases [BR:pbrv01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   138171419 (MAPK1)
Chromosome and associated proteins [BR:pbrv03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     138171419 (MAPK1)
Exosome [BR:pbrv04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   138171419 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kinase-like Kdo
Other DBs
NCBI-GeneID: 138171419
NCBI-ProteinID: XP_068957019
LinkDB
Position
Unknown
AA seq 367 aa
MAAAAGGGGGGGGGGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAI
KKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPAIEQMKDVYIVQDLMETDLY
KLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARV
ADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHY
LDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADPKALDLLDKM
LTFNPHKRIEVEQALAHPYLEQYYDPSDEPVAEAPFKFDMELDDLPKEKLKELIFEETAR
FQPGYRS
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggcggcggcggcgggaggcggcggcggcggcggcggcggcggcgcggggcccgagatg
gtccgcgggcaggtgttcgacgtgggcccgcgctacaccaacctctcctacatcggcgag
ggcgcctacggcatggtgtgttctgcttatgacaacgtcaacaaggtccgagtggccatc
aagaaaataagcccctttgagcaccagacctactgccagcggaccctgcgtgagatcaag
atcttgctgcgcttccgccatgagaacatcatcggcatcaacgacatcatccgggccccg
gccatcgagcagatgaaagacgtgtacatagtgcaggacctcatggagacagacctctac
aagctcctgaagacgcagcatctcagcaatgaccacatctgttatttcctctatcagatt
ctgagaggtttaaagtacatccactcagccaacgtcctgcaccgtgacctcaagccttcc
aacctgctgctcaacaccacctgcgatctcaagatctgtgactttggcctggctcgtgtc
gcagatccagaccatgaccacacaggcttcctgacagagtacgtggccacgcgctggtac
cgtgcacctgaaatcatgctgaactccaagggttacaccaagtccattgacatctggtct
gtgggctgcatcctggcggagatgctctccaacagacccattttccctggaaaacattac
cttgatcagctgaaccacatccttggcattcttgggtccccatcacaagaagacttgaac
tgcataatcaacttaaaagccaggaactacttgctctctctccctcacaagaacaaggtg
ccgtggaatcgactcttccccaatgccgaccccaaagctctggacttgttggataagatg
ttgacatttaaccctcataagaggattgaggtggaacaggccctggcccatccctacctg
gagcagtattatgacccaagtgatgagcctgtggccgaagccccattcaagtttgacatg
gaactggacgacctgcctaaggagaagctgaaagaactgatttttgaagagactgccaga
ttccagcccggataccgatcttaa

DBGET integrated database retrieval system