Paraburkholderia bryophila: NDK50_01645 Help Entry NDK50_01645       CDS       T08797                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism pbry  Paraburkholderia bryophila Brite KEGG Orthology (KO) [BR:pbry00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pbry03110]     NDK50_01645 (grxC) Chaperones and folding catalysts [BR:pbry03110]  Protein folding catalysts   Protein disulfide isomerase    NDK50_01645 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Glrx-like Thioredoxin_2 SH3BGR Motif Other DBs NCBI-ProteinID:  WCM20208 LinkDB All DBs Position 1:359453..359716 Genome browser AA seq 87 aa AA seqDB search MNKVIMYSTQVCPYCQMAERLLKSRGVEHVEKVLIDKDPARREEMMTRTGRRTVPQVFIG ETHVGGYDDLSALDRAGGLMPLLEATA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt gtgaacaaagtgatcatgtacagcacccaggtgtgcccgtattgccagatggccgaacgt cttttaaagtcgcgcggcgtcgagcatgttgagaaggtactgatcgacaaggacccggcc cgtcgtgaagaaatgatgacccggacgggtcgtcgcacggtgccgcaggtgttcatcggc gagacgcatgtcggcgggtacgatgacctgtccgcgctcgaccgcgcgggcggtttgatg ccgctgctcgaagcaaccgcctga

DBGET integrated database retrieval system