Paraburkholderia bryophila: NDK50_15610 Help Entry NDK50_15610       CDS       T08797                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pbry  Paraburkholderia bryophila Pathway pbry00998   Biosynthesis of various antibiotics pbry01100   Metabolic pathways pbry01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pbry00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NDK50_15610 (acpP)    00074 Mycolic acid biosynthesis     NDK50_15610 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NDK50_15610 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  WCM18848 LinkDB All DBs Position 1:complement(3487286..3487525) Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaatatcgaacagcgcgtcaagaagatcgtcgcagaacaactgggcgttgcagaa gctgagatcaagaacgaagcttcgttcgtgaacgacctcggcgccgactcgctcgacacc gttgaactcgtgatggccctcgaagacgaattcggcatggaaattccggatgaagaagcc gagaagatcaccaccgttcagcaagcgatcgactacgctcgcgcgaacgtcaaggcctaa

DBGET integrated database retrieval system