Rubinisphaera brasiliensis: Plabr_2501 Help Entry Plabr_2501        CDS       T01431                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism pbs  Rubinisphaera brasiliensis Pathway pbs01100   Metabolic pathways pbs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pbs00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Plabr_2501    00074 Mycolic acid biosynthesis     Plabr_2501   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Plabr_2501 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 Guanylate_cyc Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  ADY60102 UniProt:  F0SPV2 LinkDB All DBs Position complement(2985932..2986162) Genome browser AA seq 76 aa AA seqDB search MDIEEKVIGIVSEQLNFPKEEITTASSFQEDLKADSLDLVELVMEFEEEFDITIPDDDYE KIRTVGDAVKYIQEKT NT seq 231 nt NT seq  +upstreamnt  +downstreamnt gtggacatcgaggaaaaagttatcggcatcgtcagtgagcagctcaacttccctaaggaa gagatcactaccgccagctcctttcaggaagacctgaaagccgattcgctcgacctggtc gaactggtcatggagttcgaagaagaattcgacatcaccattccggatgacgattacgaa aaaatccggactgtcggtgatgccgtgaaatacattcaagaaaagacctga

DBGET integrated database retrieval system