Fermentimonas caenicola: ING2E5B_0400 Help Entry ING2E5B_0400      CDS       T03818                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pbt  Fermentimonas caenicola Pathway pbt00020   Citrate cycle (TCA cycle) pbt00720   Other carbon fixation pathways pbt01100   Metabolic pathways pbt01110   Biosynthesis of secondary metabolites pbt01120   Microbial metabolism in diverse environments pbt01200   Carbon metabolism pbt01210   2-Oxocarboxylic acid metabolism Module pbt_M00009   Citrate cycle (TCA cycle, Krebs cycle) pbt_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:pbt00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     ING2E5B_0400   09102 Energy metabolism    00720 Other carbon fixation pathways     ING2E5B_0400 Enzymes [BR:pbt01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      ING2E5B_0400 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_21 Fer4_2 Fer4_10 Fer4_9 Fer4_6 Fer4_16 Fer4_15 LdpA_Fe-S-bd Fer4_4 Fer4_3 Fer4_22 Fer4_17 Fer4_13 Fer4_8 Fer4_18 Motif Other DBs NCBI-ProteinID:  CEA15169 UniProt:  A0A098BWX2 LinkDB All DBs Position chrI:439208..439438 Genome browser AA seq 76 aa AA seqDB search MAKFIGYVVVDKDHCKGCDLCVVSCPTDVLELEPREVNDRGYHYVYMKNPDDCIGCANCG YVCPDACLTVYKKKVG NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcaaaattcattggttatgttgtggtagataaagatcactgtaaagggtgtgatctt tgtgttgtatcatgtcctactgacgttcttgaacttgaaccacgcgaagttaacgatcgc gggtatcactatgtgtatatgaaaaatcccgatgattgtattggatgtgcaaactgcgga tatgtttgtccggatgcatgtcttacagtttacaagaaaaaagtgggctaa

DBGET integrated database retrieval system