Fermentimonas caenicola: ING2E5B_1774 Help Entry ING2E5B_1774      CDS       T03818                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism pbt  Fermentimonas caenicola Pathway pbt03060   Protein export pbt03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:pbt00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     ING2E5B_1774  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     ING2E5B_1774  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:pbt02044]     ING2E5B_1774 Secretion system [BR:pbt02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    ING2E5B_1774 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  CEA16518 UniProt:  A0A098C285 LinkDB All DBs Position chrI:1993939..1994142 Genome browser AA seq 67 aa AA seqDB search MNPLLINLNGWEIPIIVIVILILFGGKKIPEFMKGLGKGINSFKKGLNDIEEDIKADPSD NKTTGDK NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgaatccattacttattaatttaaacggttgggaaatacctattattgttatagtaatt ctgatacttttcggtggtaaaaaaatacctgaattcatgaaaggcctcggaaaaggtatt aacagctttaagaaagggttgaatgatattgaagaagatatcaaagcagatccttcagat aataaaacaacaggcgataaataa

DBGET integrated database retrieval system