Pseudomonas bubulae: V6B39_20125
Help
Entry
V6B39_20125 CDS
T10711
Name
(GenBank) acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha
KO
K01968
3-methylcrotonyl-CoA carboxylase alpha subunit [EC:
6.4.1.4
]
Organism
pbub Pseudomonas bubulae
Pathway
pbub00280
Valine, leucine and isoleucine degradation
pbub01100
Metabolic pathways
Module
pbub_M00036
Leucine degradation, leucine => acetoacetate + acetyl-CoA
Brite
KEGG Orthology (KO) [BR:
pbub00001
]
09100 Metabolism
09105 Amino acid metabolism
00280 Valine, leucine and isoleucine degradation
V6B39_20125
Enzymes [BR:
pbub01000
]
6. Ligases
6.4 Forming carbon-carbon bonds
6.4.1 Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
6.4.1.4 methylcrotonoyl-CoA carboxylase
V6B39_20125
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CPSase_L_D2
Biotin_carb_N
Biotin_carb_C
Biotin_lipoyl
Dala_Dala_lig_C
ATP-grasp
BT_MCC_alpha
Biotin_lipoyl_2
ATP-grasp_3
ATPgrasp_ST
GARS_A
DUF3182
LAL_C2
ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID:
WWR37248
UniProt:
A0ABZ2H357
LinkDB
All DBs
Position
4433689..4435629
Genome browser
AA seq
646 aa
AA seq
DB search
MSAPILTSVLVANRGEIACRVMRTARALGLTTVAVHSATDRDARHCREADICVDLGGSKA
ADSYLKIDKIIAAAKASGAQAIHPGYGFLSENAGFARAIEAAGLIFLGPPASAIDAMGSK
SAAKTLMEVAGVPLVPGYHGEAQDLETFRLAAERIGYPVLLKATAGGGGKGMKVVEDVAQ
LAEALASAQREALSSFGDARMLVEKYVLKPRHVEIQIFADQHGNCLYLNERDCSIQRRHQ
KVVEEAPAPGLSVEQRQAMGESAVRAAQAIGYVGAGTVEFLLDARGEFFFMEMNTRLQVE
HPVTEAITGLDLVAWQIRVARGETLPISQAQVPLNGHAIEVRLYAEDPGHDFLPQTGRLE
VYRESAAGPGRRVDSGVSEGDEVSPFYDPMLGKLIAWGEDREQARLRLMAMLDEFAIGGL
KTNLNFLRRIIGHPAFAAAELDTGFIPRYEEELLPAAEPLPTAFWSAAAQAFSQSQPLRV
RNDDPASPWSTANGFRSGLPANTLLVLACKGEQQVIHLSGNTTTLRDEHLLIEQDGVRRQ
HLAIRRGDALYLRWDGELHCVRLHDPISAVDASHTAQGGLTAPMNGSIVRVLVEVGQTVE
AGAQLVVLEAMKMEHSLRAPHAGVIKALFYQEGEMVSEGSALVELE
NT seq
1941 nt
NT seq
+upstream
nt +downstream
nt
atgagcgcccctattctgacatccgtactggttgccaaccgtggcgaaatcgcctgccgg
gtaatgcgcacagccagggccctgggcctcaccacagtagccgtccacagcgcgaccgat
cgcgatgcgcggcattgccgcgaagccgatatctgcgtagacctggggggcagcaaagcg
gccgacagctacctgaaaatcgacaagatcattgcagccgccaaggccagtggggcccag
gccattcatcccggttatggctttttgtcggagaacgcaggctttgcccgtgccattgaa
gctgccgggctgatatttctcggcccgcccgccagtgccattgatgccatgggcagcaag
tccgccgccaagaccttgatggaagtggcgggcgtaccgctggtgccgggttaccacggc
gaagcccaggatctggaaacctttcgcctcgccgcagaacgcatcggctatccggtgctg
ctcaaagccacggcaggaggtggcggcaagggcatgaaggtggtcgaggacgtcgcccag
ctggcagaggcgctggcctcggcacagcgcgaagccctgtcgtcctttggcgatgcgcgc
atgctggtggaaaagtacgtactcaagccacgacacgtggaaatccagatttttgccgac
cagcacggcaactgcctgtacctcaatgagcgcgactgctcgattcagcgccgccaccag
aaagtcgtagaggaagcgccagcaccgggcctgagtgtcgaacagcgtcaggcaatgggc
gagtccgccgtgcgtgcggcccaggccatcggttatgtgggcgcgggcactgtagagttc
ctgctggatgcgcgaggcgaattcttctttatggagatgaatacgcgcctgcaggttgag
cacccggtcactgaagccatcaccggcctcgacctggtggcctggcaaatccgcgtggca
cgaggtgaaaccctgcccatcagccaggctcaggtcccgttgaacggccatgccatagaa
gtgcgactgtatgcagaagacccgggccatgatttccttccgcaaaccggccgtcttgag
gtgtatcgcgagtcggccgctggcccgggccgtcgcgtggacagcggtgtcagcgagggc
gacgaagtttcaccgttctacgacccgatgctgggcaagctgattgcttggggtgaagac
cgcgaacaggcacgtttgcgcctgatggccatgctcgatgaattcgctattggcgggctg
aaaaccaacctgaatttcttgcgccgcattatcggccaccctgccttcgccgcagccgaa
ctcgataccggatttatcccacgctacgaagaagaattactgcctgctgccgaacctttg
cctacggcattctggtctgccgctgcccaggcattcagccaaagtcaaccgctacgggta
cgcaacgatgacccggcatcgccctggtcgacagccaatggctttcgtagcggtctgccg
gcaaacaccttgctggttctggcctgcaagggtgaacagcaggttatccacctcagtggc
aacaccaccactttgcgcgatgaacacttgctcatcgagcaggacggtgtacgccgtcag
cacctggccatccgtcggggcgatgcgctgtacctgcgctgggacggtgaactgcactgc
gtgcgtctgcacgatccgatcagcgccgtggacgccagtcacacggcccagggcggcctg
actgcaccgatgaacggcagcatcgtacgtgtgctggtcgaggtcgggcaaaccgtcgag
gccggtgctcagctggtggtactggaagccatgaaaatggaacacagcctgcgagccccc
catgcaggcgtgatcaaggcgctgttttaccaggaaggtgaaatggtcagtgagggttcg
gcactggtcgagctggaatga
DBGET
integrated database retrieval system