KEGG   Pseudomonas bubulae: V6B39_22240
Entry
V6B39_22240       CDS       T10711                                 
Name
(GenBank) homoserine dehydrogenase
  KO
K00003  homoserine dehydrogenase [EC:1.1.1.3]
Organism
pbub  Pseudomonas bubulae
Pathway
pbub00260  Glycine, serine and threonine metabolism
pbub00270  Cysteine and methionine metabolism
pbub00300  Lysine biosynthesis
pbub01100  Metabolic pathways
pbub01110  Biosynthesis of secondary metabolites
pbub01120  Microbial metabolism in diverse environments
pbub01230  Biosynthesis of amino acids
Module
pbub_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pbub00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    V6B39_22240
   00270 Cysteine and methionine metabolism
    V6B39_22240
   00300 Lysine biosynthesis
    V6B39_22240
Enzymes [BR:pbub01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.3  homoserine dehydrogenase
     V6B39_22240
SSDB
Motif
Pfam: Homoserine_dh NAD_binding_3 ACT ACT_AHAS_ss ACT_4 ACT_9 GFO_IDH_MocA ACT_7 DXP_reductoisom ACT_6 Sacchrp_dh_NADP
Other DBs
NCBI-ProteinID: WWR37642
UniProt: A0ABZ2H5K3
LinkDB
Position
complement(4895803..4897107)
AA seq 434 aa
MNPVKVGICGLGTVGGGTFNVLKRNAEEIARRAGRGIQVAQIAMRTPNPQCDITGTPITN
DVFAVATNPEIDIVIELIGGYTIARELVLKAIENGKHVVTANKALIAVHGNEIFAKAQEK
GVIVAFEAAVAGGIPVIKAIREGLSANRINWVAGIINGTGNFILTEMREKGRTFEDVLAE
AQALGYAEADPTFDVEGIDAAHKLTILASIAFGIPLQFDKAYTEGITKLTTADVNYAEAL
GYRIKHLGVARSTANGIELRVHPTLIPADRLIANVNGVMNAVMVNGDAAGSTLFYGAGAG
MEPTASSVVADLVDVVRAMTSDPENRVPHLAFQPDLLSDHPILPIEACESAYYLRIQAKD
HPGVLAQVASILSERGINIESIMQKEVEEHDGLVPMILLTHRVIEQHINDAIAALEALQG
VVGPVVRIRVEHLN
NT seq 1305 nt   +upstreamnt  +downstreamnt
gtgaatccggtcaaagtaggtatctgtgggctcgggaccgtcggtggcggcaccttcaac
gtactaaagcgtaacgccgaggagattgcccgccgtgccgggcgtggtatccaggttgcg
caaattgcaatgcgtacgccaaaccctcagtgcgacattaccggtacccccattaccaac
gatgtattcgctgttgcgaccaaccctgaaatcgacattgttatcgagctgattggtggt
tacaccatcgcccgtgaactggtgctcaaggccatcgaaaacggcaagcatgtcgtgacc
gcgaacaaggcgctgattgccgttcacggtaatgaaatcttcgccaaagcccaggaaaag
ggcgtgatcgtggcgttcgaagcggccgttgcaggcggtatcccggtgatcaaggcgatc
cgtgaaggtctctcggccaatcgtatcaactgggtggcgggcatcatcaacggtaccggt
aacttcatcctcaccgaaatgcgcgaaaaaggccgtacgttcgaagacgtgctggctgaa
gcacaagcgctgggttatgccgaggcagacccgacgtttgacgttgaaggtatcgatgcg
gcgcacaagctgaccattctggcgtcgattgctttcggtatcccgttgcagttcgacaag
gcctacaccgaaggcatcaccaagctgacaaccgctgatgtgaattacgcagaggcgctg
ggttatcgcatcaagcatctgggtgttgcacgcagcacggccaacggcatcgagttgcgg
gttcacccgacgctgattccggctgaccgcctgatcgccaacgtcaacggcgtaatgaac
gcagtcatggtcaacggtgacgctgccggttcgaccctgttctatggtgctggcgccggt
atggaaccaacggcttcgtccgtggttgccgacctggtagacgtggtgcgtgccatgacc
agcgacccggaaaaccgcgtaccgcacctggccttccagccggatctgctctccgaccat
ccgatcctgccgatcgaagcgtgcgaaagcgcctactacctgcgcatccaggccaaagat
cacccgggcgtattggcccaggtggcgagcatcttgtccgagcgcggcatcaacatcgaa
tcgatcatgcagaaagaagtcgaagagcatgacggcctggtgccaatgatcctgttgacc
catcgggtaattgaacagcacatcaacgatgccattgccgcgcttgaagcattgcagggc
gttgtgggtccggtcgttcgcatccgcgttgagcatcttaattaa

DBGET integrated database retrieval system