Hoylesella buccalis: LK429_09485 Help Entry LK429_09485       CDS       T08692                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pbuc  Hoylesella buccalis Pathway pbuc00020   Citrate cycle (TCA cycle) pbuc00720   Other carbon fixation pathways pbuc01100   Metabolic pathways pbuc01110   Biosynthesis of secondary metabolites pbuc01120   Microbial metabolism in diverse environments pbuc01200   Carbon metabolism pbuc01210   2-Oxocarboxylic acid metabolism Module pbuc_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:pbuc00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     LK429_09485   09102 Energy metabolism    00720 Other carbon fixation pathways     LK429_09485 Enzymes [BR:pbuc01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      LK429_09485 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_2 Fer4_21 Fer4_10 Fer4_9 Fer4_6 Fer4_16 Fer4_4 Fer4_15 Fer4_8 Fer4_17 Fer4_22 Chordopox_G2 Fer4_3 Fer4_ETF_QO Fer4_18 Motif Other DBs NCBI-ProteinID:  UEA62289 LinkDB All DBs Position 2339157..2339390 Genome browser AA seq 77 aa AA seqDB search MSKMKGAIVVNTDRCKGCSLCMVACPQKVIELAQKQVNTHGYRYAQAVNPDDCVGCAACG IVCPDGCITVYRKRVEA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaagatgaaaggagccatagttgtgaataccgatcgctgtaaaggatgttcactc tgcatggtggcatgtccgcaaaaggtgatcgaactggctcagaaacaagtgaacacgcac ggatacagatatgcacaggccgtgaacccagatgattgtgtgggttgtgcggcatgcggc atcgtttgtccggatggttgtataaccgtttatagaaaacgagtggaggcgtaa

DBGET integrated database retrieval system