Peribacillus butanolivorans: DTO10_12440
Help
Entry
DTO10_12440 CDS
T06699
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
pbut
Peribacillus butanolivorans
Pathway
pbut03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
pbut00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
DTO10_12440
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
pbut03011
]
DTO10_12440
Ribosome [BR:
pbut03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
DTO10_12440
Bacteria
DTO10_12440
Archaea
DTO10_12440
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
DpnD-PcfM
Motif
Other DBs
NCBI-ProteinID:
AXN39135
UniProt:
A0AAX0S8S9
LinkDB
All DBs
Position
2580710..2581072
Genome browser
AA seq
120 aa
AA seq
DB search
MITKLDKNATRQKRHARVRAKLSGTEARPRLNVFRSNKHIYAQLIDDAKGVTLASASTLD
KEIGIEASSNAEAAQKVGELIAKRAVEKGFKAVVFDRGGYLFHGRVKALADAARENGLEF
NT seq
363 nt
NT seq
+upstream
nt +downstream
nt
atgattacgaagcttgataaaaatgctactcgtcagaaaagacatgcacgtgtgcgtgca
aagctttctggaacagaagctcgtcctcgtttaaatgtgtttcgttcaaacaaacacatt
tacgcacaattaattgacgatgcaaaaggcgtaacattagcaagtgcttcaactcttgat
aaagagatcggtatcgaagctagtagcaatgctgaagcagctcaaaaagttggcgaactt
attgcgaaacgtgctgttgaaaaaggtttcaaagctgtggtatttgaccgcggtggttac
ctcttccatggtcgtgttaaagcattggctgacgctgctcgtgaaaacggcttagaattt
taa
DBGET
integrated database retrieval system