Pieris brassicae (large cabbage white): 123709881 Help Entry 123709881         CDS       T08632                                  Name (RefSeq) centromere protein S-like   KO K11511   centromere protein S Organism pbx  Pieris brassicae (large cabbage white) Pathway pbx03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:pbx00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     123709881  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pbx03036]     123709881    03400 DNA repair and recombination proteins [BR:pbx03400]     123709881 Chromosome and associated proteins [BR:pbx03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      123709881 DNA repair and recombination proteins [BR:pbx03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      123709881 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C Bromo_TP TFIID_20kDa Histone TAF TFIID-18kDa Motif Other DBs NCBI-GeneID:  123709881 NCBI-ProteinID:  XP_045517429 LinkDB All DBs Position 5:21048108..21052467 Genome browser AA seq 135 aa AA seqDB search MTMFQNLSPTQKLQAAVHKDVRGICTEACHFLGLEITKPAIEVIAELVFKKCRVYGSDLE AFAKHAKRSTINAEDVKLLVRRNLSLKSRLHSLSSNSGKDKRRKTVPAVKQDESKESKES DIEDMVADQIDLTFD NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atgactatgtttcagaatctatcaccaacccagaagttgcaagcggccgtacataaagac gtacgaggtatttgtactgaggcttgccactttctaggcttggaaatcactaaaccagca atcgaagtgattgcggagctggtttttaagaaatgccgtgtatatggatcagatttagag gcattcgctaaacacgcaaaacgttcaacaatcaacgctgaagatgtcaagttattagtt cgaagaaatctatctctgaaatcacgcctccactcgctaagttccaactctggaaaggat aaacgaaggaaaacagtgccagcagtgaaacaagatgaatctaaagagtcgaaggagtcg gacatcgaagatatggtggccgatcaaatcgacctcacctttgattaa

DBGET integrated database retrieval system