Pieris brassicae (large cabbage white): 123714946 Help Entry 123714946         CDS       T08632                                  Name (RefSeq) synaptobrevin-1-like   KO K13504   vesicle-associated membrane protein 2 Organism pbx  Pieris brassicae (large cabbage white) Pathway pbx04130   SNARE interactions in vesicular transport pbx04145   Phagocytosis Brite KEGG Orthology (KO) [BR:pbx00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04130 SNARE interactions in vesicular transport     123714946  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     123714946  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pbx04131]     123714946 Membrane trafficking [BR:pbx04131]  SNARE   VAMP, Ykt6, Sec22 (R)    VAMP     123714946  Endoplasmic reticulum (ER) - Golgi transport   Forward pathways    Rab associated proteins     123714946 SSDB OrthologParalogGFIT Motif Pfam:  Synaptobrevin MCU SpoIIM Tuftelin_like SPC12 UstYa Motif Other DBs NCBI-GeneID:  123714946 NCBI-ProteinID:  XP_045525600 LinkDB All DBs Position 10:2271503..2273198 Genome browser AA seq 121 aa AA seqDB search MENQGTSGPRVSDKRLAQTQAQVDEVVGIMRVNVEKVLERDQKLSELDNRADALQHGAAQ FEQQAGKLKRKYWWQNLKMMLIIGAVGAVLLIIIIVWATSGSSSPSAPPPVNPSPETPSG R NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggaaaaccaaggcacctccggaccgagagtaagcgataaacgattagctcagacacaa gctcaagtagatgaggtcgttggtattatgcgtgtaaatgtcgagaaagtgttggaacgc gaccaaaagttgtcagaactggacaatcgtgcagatgctctacaacatggagcggcgcaa ttcgaacaacaggctggtaagcttaagaggaagtactggtggcaaaatcttaaaatgatg ttgataattggtgcggtgggagctgtcctcctcattattattattgtgtgggccacatcg ggttcaagctcaccctctgctccaccgccagtcaatccatctccagagacaccatcagga cgataa

DBGET integrated database retrieval system