Pseudomonas bijieensis: GN234_15770 Help Entry GN234_15770       CDS       T07266                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pbz  Pseudomonas bijieensis Pathway pbz01100   Metabolic pathways pbz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pbz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GN234_15770    00074 Mycolic acid biosynthesis     GN234_15770   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GN234_15770 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QKS83315 UniProt:  A0A6N1CF53 LinkDB All DBs Position 3625872..3626129 Genome browser AA seq 85 aa AA seqDB search MSDLHRDIKQLIIDALGLEDISIDDIGDHQTLFGEGLGLDSVDALELGLAIQKKYGIKID ADAKDTRNHFSNVASLAAFVTAKSA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgagcgatctgcaccgtgacatcaaacagctgatcatcgatgccctcggcctggaggac ataagcatcgacgatatcggcgaccaccagaccctgttcggcgaaggcctgggcctggac tcggtggatgccctggagctaggcctggcgatccagaagaagtacggcatcaagatcgat gccgacgccaaggacacccgtaaccatttcagcaatgtggcaagccttgcggccttcgtc actgcaaaaagcgcctga

DBGET integrated database retrieval system